HEKSAFLOROSİLİSİK ASİT

Heksaflorosilisik asit = FLOROSİLİSİK ASİT = FLUOSİLİSİK ASİT = Kum asidi = Silikoflorik asit

Heksaflorosilisik asit Uygulamaları = Kimyasal Ara Ürün, Metal Yüzey İşlemi, Su Florlama, Ahşap Koruma, Cam Katkı Maddesi, Seramik Sertleştirme
Heksaflorosilisik asit, birçok endüstriyel ve belediye operasyonlarında kullanılan renksiz, suda çözünür bir sıvıdır. Keskin bir kokusu vardır ve doğası gereği oldukça aşındırıcıdır. Su florlama, elektrokaplama ve çimento ve emaye imalatı gibi uygulamalarda yaygın olarak kullanılır. Artan talebi, heksaflorosilik asitin su arıtma tesislerinde, özellikle de kamusal su kaynaklarının floridasyonunda kullanılmasına bağlanabilir.


Heksaflorosilisik asit
EC Numarası: 241-034-8
EC Adı: Heksaflorosilisik asit
CAS Numarası: 16961-83-4
Moleküler formül: F6Si.2H
IUPAC Adı: heksaflorosilikat


FLOROSİLİK ASİT
Heksaflorosilisik asit
Dihidrojen heksaflorosilikat
Fluosilisik asit
Hidrosilikoflorik asit
CAS #: 16961-83-4
BM #: 1778
EC Numarası: 241-034-8

Hekzaflorosilisik asit, H2SiF6 kimyasal formülü (H3O) 2 [SiF6] olarak da yazılan inorganik bir bileşiktir.Hekzaflorosilisik asit, çoğunlukla seyreltilmiş sulu çözelti olarak karşılaşılan renksiz bir sıvıdır, oradan ikinci kimyasal notasyon da önerilmiştir.
Heksaflorosilisik asitin kendine özgü ekşi bir tadı ve keskin bir kokusu vardır. Doğal olarak büyük ölçüde yanardağlarda üretilir.
Heksaflorosilisik asit, fosfatlı gübrelerin üretiminde bir yardımcı ürün olarak üretilmektedir.
Elde edilen heksaflorosilisik asit neredeyse yalnızca alüminyum işlemede kullanılan alüminyum triflorür ve sentetik kriyolit için bir öncü olarak tüketilir.
Heksaflorosilisik asitten türetilen tuzlara heksaflorosilikatlar denir.

Hekzaflorosilisik asit, genellikle bir florür kaynağı olarak kullanılır. Çeşitli faydalı heksaflorosilikat tuzlarına dönüştürülür. Kurşunun rafine edilmesi için Betts elektrolitik işleminde bir elektrolit olarak da kullanılır. Silil eterlerin Si-O bağlarını parçalamak için önemli bir organik reaktiftir. Ayrıca, ahşap bir koruma maddesi olarak kullanılır ve ayrıca kalsiyum karbonatın yüzey modifikasyonunda kullanılır.


Heksaflorosilisik asit, güçlü oksitleyici maddeler, metaller, alkaliler, güçlü asitler, taş ürünleri ve cam ile uyumsuzdur.
Fluosilisik asit, Heksaflorosilisik asit
CAS: 16961-83-4
Renksiz dumanlı bir sıvı.

Bilinen Diğer İsimler: fluosilisik asit, hekzaflorosilik asit, hidrojen hekzaflorosilikat, hidrosilikoflorik asit

Moleküler Formül: H2SiF6


Sodyum heksaflorosilikat ve florosilik asidin başlıca kullanımı içme suyu için florlama ajanları olarak kullanılır.
Sodyum heksaflorosilikat ayrıca bir silikofosfat çimentosu, monokalsiyum fosfat monohidrat ile kombinasyon halinde asidik bir jel ve iki solüsyonlu florür ağız durulamasının bir parçası olarak çürük kontrolü için kullanılmıştır. Her iki kimyasal da alüminyum triflorür, kriyolit (Na3AlF6), silikon tetraflorür ve diğer florosilikatlar için kimyasal bir ara ürün (hammadde) olarak kullanılır ve ticari çamaşırhanede uygulamalar bulmuştur.
Sodyum heksaflorosilikat için diğer uygulamalar arasında, porselen ve porselen için emaye / emaye fritlerde, yanardöner camda, metalurjide (alüminyum ve berilyum), yapıştırıcıda, cevher yüzdürmede, deri ve ahşap koruyucularda ve böcek öldürücüler ve rodentisitlerde kullanımı yer alır. Saf silikon üretiminde, kalıplanmış lateks köpüğün üretiminde bir jelleştirici madde olarak ve organodiklorofosfor bileşiklerini karşılık gelen organodiflorofosfor bileşiğine dönüştürmek için organik sentezde bir florlama maddesi olarak kullanılmıştır.
Veterinerlik uygulamalarında, sodyum heksaflorosilikatın harici uygulaması, sığır, koyun, domuz ve kümes hayvanları üzerindeki bitler ve sivrisineklerle savaşır ve ağızdan uygulama, domuzlardaki yuvarlak kurtlarla ve muhtemelen kamçı kurtlarıyla savaşır ve sıçanlarda diş çürüklerini önler. Görünüşe göre, tüm pestisit ürünlerin kayıtları iptal edildi veya 1990'ların başında durduruldu.
Florosilisik asit, hayvan postlarının ve derilerinin tabaklanmasında, seramiklerde ve camlarda, teknik boyalarda, yağ kuyusu asitleştirilmesinde, hidrojen florür imalatında, ekipmanların sterilizasyonu için (örneğin, bira ve şişeleme işletmelerinde ve bakır için) kullanılır. ve pirinç araçlar) ve elektro kaplamada.
Aynı zamanda ahşabı korumak ve duvarları sertleştirmek ve tekstildeki küf, pas ve lekeyi çıkarmak için emprenye edici bir bileşen olarak kullanılır.

Heksaflorosilisik asit Uygulamalar: su florlama, bakır ve pirinç kapları dezenfekte etme, şişeleme ve demleme ekipmanlarını sterilize etme

Florosilik asit, su floridasyonunda kullanılan ana ürünlerden biridir.

Hidroflorosilisik asit, genellikle florosilik asit, fluosilik asit, silikoflorür ve silikoflorik asit gibi diğer isimlerle bilinen bir kimyasaldır ve genellikle HSA veya FSA olarak kısaltılır. Yerden fosforik kayayı alıp çözünür gübreye dönüştürdüğünüzde oluşan renksiz bir kimyasaldır. Bu işlemde, biri hidrojen florür olmak üzere iki çok toksik florür gazı açığa çıkar; diğeri silikon tetraflorürdür. Bu hidrojen florürden gelen yoğunlaşma toplanır, ardından suyla temizlenir.

Hidroflorosilisik asit, nadiren seyreltilmemiş bulunan renksiz bir sıvı ve inorganik bileşiktir. Keskin bir kokusu ve karakteristik ekşi bir tadı vardır. Hidroflorosilik asit konsantre haliyle toksik ve aşındırıcıdır. Esas olarak sentetik kriyolit ve alüminyum triflorür için bir öncü olarak üretilir. Ayrıca, sudaki florür seviyesini korumak için su arıtımında da yaygın olarak kullanılır.

Hidroflorosilisik Asitle Hangi Sektörler ve Uygulamalar İşlenir?
Hidroflorosilisik asitin en yaygın bilinen uygulaması, su arıtma tesislerinde su floridasyonudur. İçme suyunu arıtmak için de kullanılabilen bir alternatif olan sodyum florürden 5 kat daha ucuzdur. Sonuç olarak, hidroflorosilik asit, son yıllarda talepte büyük bir artış gördü. Bununla birlikte, yüzde 20'nin üzerindeki konsantrasyonların saklanması ve kullanılması sodyum florürden daha tehlikelidir ve yeterli bakım ve ekipman gerektirir.

Dünyadaki en büyük hidroflorosilisik asit miktarı kriyolit ve alüminyum florüre dönüştürülür. Bu malzemeler, alüminyum cevherini alüminyum metale dönüştürme sürecinde kilit önemdedir.

Hidroflorosilisik asit ayrıca Betts elektrolitik işleminde kurşunun rafine edilmesi için bir elektrolit olarak ve bazı pas sökücü temizlik ürünlerinde aktif bileşik olarak kullanılır.


Florosilisik Asit (H2SiF6), aşağıdaki uygulamalarda temel bir kimyasaldır:

Su arıtma
Yüzey işleme
Galvanoteknik
Kurşun arıtma
Cam endüstrisi
İçme suyu arıtma
Seramik
Kimyasal endüstri
Emaye
Kimyasal sentez

Florosilisik Asit
Florosilisik asit (FSA olarak da bilinir), içilebilir suda bir florür kaynağı olarak kullanılır. Bu, dişlerdeki boşlukların önlenmesine yardımcı olur. Kimyasal formülü (H2SiF6) olan inorganik bir bileşiktir.

Tekstil Kimyasalları ve Boyaları
Florosilisik Asit, endüstriyel tekstil işleme veya çamaşırhanelerde pH ayarlaması için kullanılır.
Tekstil işleme, 2019'da% 12,67'lik payla florosilik asitin en büyük uygulamalarından biridir. Ürün, üstün temizleme özellikleri sayesinde tekstil uygulamalarında artan talebe tanık oluyor. Kumaştan pas, leke ve küfün çıkarılmasına yardımcı olduğu için çamaşır kimyasalı veya ekşi çamaşır olarak kullanılır. Kimyasal ayrıca durulama döngüsü sırasında pH düzenlemesine yardımcı olur. Kumaş çevresinde ince bir film kaplama oluşturarak elyafı korur, bu da yüzey geriliminin azalmasına neden olur. Bu faktörlerin, tahmin dönemi boyunca tekstil işleme uygulamalarından gelen talebi artırması beklenmektedir.

İnsanların değişen yaşam tarzları ve temiz ve hijyenik giysiler konusundaki farkındalığın artması nedeniyle son yıllarda çamaşırhane sektörü ilgi görmektedir.
Bu, temiz ve hoş kokulu giysiler için yüksek bir talep yarattı.
Ayrıca, alerji ve diğer cilt hastalıklarının artan yaygınlığının, yakın gelecekte deterjanlara yüksek talep yaratması beklenmektedir.
Deterjan üreticileri, hijyen sağlamakla birlikte verimli temizlik ve kumaş ömrünü uzatmak için yüksek kaliteli ürünler geliştirmeye odaklanmıştır.
Bu faktörler nedeniyle, florosilik asitin tahmin dönemi boyunca tekstil uygulamalarında sağlıklı talebe şahit olması beklenmektedir.
Heksaflorosilik asit kumaşlardan pas ve lekelerin çıkarılmasında kullanılır ve elyaf çevresinde ince bir film kaplama oluşturarak alt tabakanın yüzey gerilimini düşürme eğilimindedir. Ayrıca, durulama döngüsü sırasında çamaşırlara eklendiğinde su pH'ını düşürmek ve temizleyicilerin ve korozyon lekelerinin çıkarılmasına yardımcı olmak için bir çamaşır kimyasalı gibi davranarak pazar talebini teşvik eder.

Su arıtma
Florosilisik Asit, suyun florlanması için bir florür kaynağı olarak kullanılır.
Heksaflorosilik asit, genel su arıtma tesislerinde, kamu su kaynaklarının florür içeriğini düzenleyerek diş çürüklerini azaltmak için kullanılır.Hekzaflorosilisik asit, su arıtma tesislerine ilave edilerek, diş çürümesini azaltmak için aktif bileşen olarak kabul edilen toplam bir florür F seviyesi elde edilir ve böylece ürün talebini artırır. ABD ve Avrupa'daki hükümet düzenlemeleri, belediye şirketlerini halka açık içme suyu için florlama maddesi olarak florosilik asit kullanmaya zorluyor. Araştırmacılar, sudaki kontrollü bir florür seviyesinin, çürükleri ve diş çürümelerini etkili bir şekilde önlediğini tespit ettiler. Topluluk suyu florlaması, diş boşluklarını önlemek için suyu florürle takviye etmenin en etkili ve ekonomik yöntemlerinden biridir. Ayrıca florosilik asit, ağırlıklı olarak su floridasyon işleminde bir florür katkı maddesi olarak kullanılır.


Diğerleri
Florosilisik Asit, kurşunu rafine etmek için Betts elektrolitik işleminde bir elektrolit olarak kullanılır.

Metal yüzey işleme ve temizleyici
Metal yüzey işleme uygulamalarında% 40 konsantrasyona sahip florosilik asit oldukça kullanılır. Alüminyum, metalin yüzeyinde oluşan alüminyum oksit tabakasına nüfuz etmek için florosilik asit gibi florürlerle işlenir. İşlem, florür iyonlarının alüminyum yüzey üzerinde koruyucu bir tabaka oluşturmasını sağlar ve bu da metalin daha fazla oksitlenmesini önler.
Florosilisik asit, belediye şirketi tarafından florür seviyesini korumak için su arıtma sürecinde kullanılır. Heksaflorosilisik asit, ürün talebini artırabilecek krom olmayan yüzey pasivasyonunu indüklediği için metal yüzey işleme proseslerinde yaygın olarak kullanılmaktadır.
Florosilisik asit, düşük klor içeriğine sahip, altı değerlikli olmayan bir krom formülü bileşeni olarak işlev görür ve yüzey işleme sürecinde stabil bir ürün görevi görür.
 

Heksaflorosilisik asit, geleneksel krom elektrolit için bir katalizör görevi gören çeşitli kimya endüstrilerinde kullanılır. Ürün, elektrokaplama işleminde indirgeyici ajan görevi görür,
 

Hidroflorosilik asit, diş macunu, gargara, diş ipi ve diş beyazlatma gibi ağız bakım ürünlerinde yaygın olarak kullanılmaktadır. Küresel ağız bakımı ürünleri talebi, 2018'de 28,5 milyar ABD dolarının üzerinde bir değere sahipti. Diş eti iltihabı, takma diş tahrişi ve diş eti kanaması gibi ağız rahatsızlıkları konusunda artan tüketici bilincinin, florosilik asit pazarındaki büyümeyi artırması muhtemeldir. Zayıf noktaları ve açıkta kalan kökleri güçlendirir ve diş çürümesinin erken aşamalarını önlemeye yardımcı olur.


Hidroflorosilisik asit ürünü, dental ürünlere eklendiğinde florür seviyelerinin korunması gibi mükemmel özellikler sunar. Dahası, sterilizasyon ve fümigasyon teknolojilerindeki artan uygulama ve hayvan postu ve tabaklanmış cama artan talebin endüstrideki büyümeyi desteklemesi muhtemeldir.

Hidroflorosilisik asit, duvarcılık ve seramiklerin sertleştirilmesinde kullanılır.

Hekzaflorosilisikik, saf silikon üretiminde, kalıplanmış lateks köpük üretiminde bir jelleştirici ajan olarak ve organodiklorofosfor bileşiklerini karşılık gelen organodiflorofosfor bileşiğine dönüştürmek için organik sentezde bir florlama ajanı olarak kullanılmıştır.
% 40 dereceli florosilisik asit, hayvan postlarının ve derilerinin tabaklanmasında, seramik ve camlarda, teknik boyalarda, yağ kuyusu asitlendirilmesinde, hidrojen florür imalatında, ekipmanların sterilizasyonunda ve elektrokaplamada kullanılmaktadır.
Heksaflorosilisik ayrıca ahşabı korumak ve duvarları sertleştirmek ve tekstil ürünlerindeki küfün yanı sıra pas ve lekenin çıkarılması için emprenye edici bir bileşen olarak kullanılır.


Florosilisik asit, cam endüstrisinde cam aşındırma uygulamaları için yaygın olarak kullanılan aşındırıcı bileşiklerden biridir. Aşındırılmış cam ürünler, inşaat ve inşaat sektöründe yaygın olarak kullanılmaktadır. Küresel dekoratif cam pazarının büyümesini teşvik eden önemli bir faktör, ticari ve konut binalarında cam ürünlere olan talebin artmasıdır. Bu nedenle, kazınmış cam ürünleri hem estetik görünümleri hem de elektrik tüketiminin azalmasıyla elde edilen enerji tasarrufu nedeniyle popülerlik kazanmaktadır. Ayrıca cam, ısı ve ses yalıtımı sağlar ve güneş radyasyonunun kontrolüne izin verir.

 Genel su arıtma tesislerinde, kamu su kaynaklarının florür içeriğini düzenleyerek diş çürüklerini azaltmak için kullanılır. Diş çürümesini azaltmak için aktif bileşen olarak kabul edilen toplam florür F düzeyini vermek için su arıtma tesislerine eklenir ve böylece ürün talebini artırır. ABD ve Avrupa'daki hükümet düzenlemeleri, belediye şirketlerini halka açık içme suyu için florlama maddesi olarak florosilik asit kullanmaya zorluyor. Araştırmacılar, sudaki kontrollü bir florür seviyesinin, çürükleri ve diş çürümelerini etkili bir şekilde önlediğini tespit ettiler. Topluluk suyu florlaması, diş boşluklarını önlemek için suyu florürle takviye etmenin en etkili ve ekonomik yöntemlerinden biridir. Ayrıca florosilik asit, ağırlıklı olarak su floridasyon işleminde bir florür katkı maddesi olarak kullanılır.

Heksaflorosilik asit DERİ TABAKLAMA UYGULAMASI
Deri tabaklama işlemi sırasında tabaklama banyosuna sulu bir dispersiyon tabakası formunda ilave edilen hekzaflorosilik asit, onu yumuşak ve uyumlu hale getirerek ürün büyümesini artırabilir.


HEXAFLOROSİLİSİK ASİT UYGULAMALARI
Ahşap Koruyucular
Galvanik
Kürk Pansuman ve Boyama
Cam İmalatı
Deri Tabaklama ve İşleme
Metal Hazırlama ve Dökme
Boyama (Pigmentler, Bağlayıcılar ve Biyositler)
Petrol Üretimi ve Rafineri
Kanalizasyon ve Atık Su Arıtma
Dezenfektanlar ve Biyositler


Genel Bakış.
Florosilisik asit ve Fosforik asit, fosfat kayanın sülfürik asit tarafından asitleştirilmesiyle yardımcı ürünler olarak üretilir. Fosfat kayası hem kalsiyum fosfat hem de kalsiyum florür içerir ve asidülasyon ile her iki ürün de elde edilir.

Florosilisik Asit yalnızca sıvı olarak var olabilir. Katı bir form yok. Seyreltilmeden nadiren karşılaşılır ve kendine özgü ekşi tadı ve keskin kokusu vardır.

Dünyadaki en büyük hidroflorosilisik asit miktarı kriyolit ve alüminyum florüre dönüştürülür. Bu malzemeler, alüminyum cevherini alüminyum metale dönüştürme sürecinde kilit önemdedir.

CAS numarası:
16961-83-4
EC Numarası:
241-034-8
Görünüm:
Renksiz
Diğer isimler:Hekzaflorosilisik Asit

Tercih edilen IUPAC adı: Heksaflorosilisik asit
Sistematik IUPAC adı: Dihidrojen hekzaflorosilikat
Diğer isimler: Florosilisik asit, fluosilik asit, hidroflorosilik asit, silikoflorür, silikoflorik asit, oksonyum hekzaflorosilanediuid, oksonyum hekzafloridosilikat (2−)

Tanımlayıcılar
CAS Numarası: 16961-83-4
EC Numarası: 241-034-8
BM numarası: 1778

Özellikleri
Kimyasal formül: F6H2Si
Molar kütle: 144.091 g · mol − 1
Görünüm: şeffaf, renksiz, dumanlı sıvı
Koku: ekşi, keskin

Yoğunluk
1.22 g / cm3 (% 25 çözülmüş)
1.38 g / cm3 (% 35 çözülmüş)
1.46 g / cm3 (% 61 çözülmüş)

Erime noktası
CA. 19 ° C (66 ° F; 292 K) (% 60–70 çözelti)
<−30 ° C (−22 ° F; 243 K) (% 35 çözelti)

Kaynama noktası: 108,5 ° C (227,3 ° F; 381,6 K) (ayrışır)
Suda çözünürlük: karışabilir
Kırılma indisi (nD): 1.3465
Yapısı
Moleküler şekil Oktahedral SiF62−

Parlama noktası: Yanıcı değil
Ölümcül doz veya konsantrasyon (LD, LC): LD50 (medyan doz): 430 mg / kg


Yapısı
Heksaflorosilisik asitin genel olarak heksaflorosilikat dianyonlar ve su ile dengelenmiş oksonyum iyonları yükünden oluştuğu varsayılır. Sulu çözeltide, hidronyum katyonu (H3O +) geleneksel olarak solvatlı bir protonla eşitlenir ve bu nedenle, bu bileşiğin formülü genellikle H olarak yazılır.
2SiF6. Bu metafor genişletilerek, izole edilmiş bileşik H2SiF6 · 2H2O veya (H3O) 2SiF6 olarak yazılır.
Durum kloroplatinik asit, floroborik asit ve heksaflorofosforik asit için olana benzer.Hekzaflorosilisikat, oktahedral bir anyondur; Si – F bağ mesafeleri 1,71 Å'dur.Hekzaflorosilisik asit sadece ticari olarak çözelti olarak mevcuttur.

Üretim ve temel reaksiyonlar
Emtia kimyasal hidrojen florür, floritten sülfürik asit ile işlenerek üretilir. [5] Bir yan ürün olarak, silika içeren mineral safsızlıkları içeren reaksiyonlar nedeniyle ton HF başına yaklaşık 50 kg (H3O) 2SiF6 üretilir. (H3O) 2SiF6 ayrıca apatit ve florapatitten fosforik asit üretiminden bir yan ürün olarak üretilir. Yine, HF'nin bir kısmı, silikon tetraflorür vermek için mineral besleme stoğunun kaçınılmaz bir bileşeni olan silikat mineralleri ile reaksiyona girer. Bu şekilde oluşan silikon tetraflorür, HF ile daha fazla reaksiyona girer. Net süreç şu şekilde tanımlanabilir: [6]

SiO2 + 6 HF → SiF2−6 + 2 H3O +
Hekzaflorosilisik asit ayrıca silikon tetraflorürün hidroflorik asit ile işlenmesiyle de üretilebilir.

Suda, heksaflorosilik asit, hidroflorik aside ve çeşitli şekillerde amorf ve hidratlanmış silikaya ("SiO2") hidrolize olur.
Genellikle su floridasyonu için kullanılan konsantrasyonda,% 99 hidroliz meydana gelir ve pH düşer. Hidroliz oranı pH ile artar.
İçme suyunun pH'ında, hidroliz derecesi esasen% 100'dür.

H2SiF6 + 2 H2O → 6 HF + "SiO2"
Alkali metal bazlarla hekzaflorosilisik asit solüsyonlarının nötralizasyonu, ilgili alkali metal florosilikat tuzlarını üretir:

(H3O) 2SiF6 + 2 NaOH → Na2SiF6 + 4 H2O
Elde edilen tuz Na2SiF6 esas olarak su floridasyonunda kullanılır. İlgili amonyum ve baryum tuzları, diğer uygulamalar için benzer şekilde üretilir.

Nötr pH'a yakın, heksaflorosilikat tuzları bu denkleme göre hızla hidrolize olur:

SiF2−6 + 2 H2O → 6 F− + SiO2 + 4 H +

KullanımlarHekzaflorosilisik asidin çoğu alüminyum florür ve sentetik kriyolit'e dönüştürülür.
Bu malzemeler, alüminyum cevherinin alüminyum metale dönüştürülmesinde merkezidir. Alüminyum triflorüre dönüşüm şu şekilde tanımlanır:

H2SiF6 + Al2O3 → 2 AlF3 + SiO2 + H2OHekzaflorosilisik asit ayrıca çeşitli faydalı heksaflorosilikat tuzlarına dönüştürülür. Potasyum tuzu, Potasyum florosilikat, porselen üretiminde, sertleştirilmiş betonlar için magnezyum tuzu ve insektisit olarak ve fosforlar için baryum tuzlarında kullanılır.
Hekzaflorosilisik asit ayrıca Betts elektrolitik işleminde kurşunun rafine edilmesi için bir elektrolit olarak kullanılır.

Oksalik asit ile birlikte hekzaflorosilik asit (etikette hidroflorosilik asit olarak tanımlanmıştır), esasen çamaşır ekşi çeşitleri olan Iron Out pas sökücü temizleme ürünlerinde kullanılan aktif bileşenlerdir.

Niş uygulamalar
H2SiF6, silil eterlerin Si – O bağlarını ayırmak için organik sentezde özel bir reaktiftir.
Bu amaç için HF'den daha reaktiftir. T-butildimetisilil (TBDMS) eterlerle triizopropilsilil (TIPS) eterlerden daha hızlı reaksiyona girer.

Heksaflorosilisik asit ve tuzları ahşap koruma maddesi olarak kullanılmaktadır.

Doğal tuzlar
Volkanik veya kömür ateşi fumarollerinde karşılaşılan bazı nadir mineraller, heksaflorosilik asit tuzlarıdır. Örnekler arasında, iki polimorf olarak doğal olarak oluşan amonyum heksaflorosilikat bulunur: kriptohalit ve bararit.

Emniyet
Heksaflorosilisik asit buharlaştığında hidrojen florür salabilir, bu nedenle benzer risklere sahiptir. Buharların solunması akciğer ödemine neden olabilir.
Hidrojen florür gibi cama ve taş eşyalara saldırır.Hekzaflorosilisik asidin LD50 değeri 430 mg / kg'dır.


Heksaflorosilisik asit Kimyasal Özellikleri, Kullanımları ve Üretimi

Açıklama
Heksaflorosilisik asit, bir tür inorganik asittir. Büyük ölçüde, Amerika Birleşik Devletleri'nde diş çürükleri ve diş florası vakalarını en aza indirmek için suyun florlanması için kullanılmaktadır. Kimyasal sentez için, büyük ölçüde alüminyum florür ve kriyolitin yanı sıra birçok türde heksaflorosilikat tuzlarının üretiminde kullanılır. Silikon ve silikon dioksit üretiminde de kullanılabilir. Kurşunun rafine edilmesi için Betts elektrolitik işleminde bir elektrolit olarak da kullanılabilir. Ayrıca silil eterlerin Si – O bağlarını parçalamak için organik sentezde özel bir reaktiftir.

Kimyasal özellikler
Hidroflorosilik asit olarak da bilinen fluosilik asit H2SiF6, suda çözünür renksiz bir sıvıdır. Oldukça aşındırıcı ve toksiktir, cama ve taş eşyaya saldırır. Fluosilicic asit, su florlamasında, elektrokaplamada ve emaye ve çimento üretiminde kullanılır.

Kimyasal özellikler
Florosilik asit şeffaf, renksiz bir dumanlı sıvıdır.

Kullanımlar
Bira ve şişeleme işletmelerinde ekipmanı sterilize etmek için yaygın olarak% 1-2'lik bir çözelti kullanılır. Diğer konsantrasyonlar, kurşunun elektrolitik rafine edilmesinde, elektrolitik kaplamada, çimento sertleştirme, ufalanan kireç veya tuğla işlerinde, tabaklama işlemi sırasında derilerden kirecin çıkarılması için, kereste koruyucu olarak kalıpların çıkarılması için kullanılır.

Genel açıklama
Penetran keskin bir kokuya sahip renksiz, dumanlı bir sıvı. Metaller ve dokular için aşındırıcıdır. Hem dumanlar hem de sıvı ile çok kısa temas şiddetli ve ağrılı yanıklara neden olabilir. Su florlamada, sertleştirmede çimento ve seramikte ahşap koruyucu olarak kullanılır.

Hava ve Su Reaksiyonları
Havada duman var. Isı ve aşındırıcı dumanların açığa çıkmasıyla suda çözünür.

Reaktivite Profili
Heksaflorosilisik asit, toksik hidrojen florür dumanları açığa çıkarmak için güçlü asitlerle (sülfürik asit gibi) reaksiyona girebilir. Cama ve silika içeren malzemelere tesir eder. Kimyasal bazlarla ekzotermik olarak reaksiyona girer (örnekler: aminler, amidler, inorganik hidroksitler). Metali çözmek ve hidrojen ve / veya toksik gazları serbest bırakmak için demir ve alüminyum dahil olmak üzere aktif metallerle reaksiyona girer. Belirli alkenlerde polimerizasyonu başlatabilir. Gaz halindeki hidrojen siyanürü açığa çıkarmak için siyanür tuzları ve bileşikleriyle reaksiyona girer. Yanıcı ve / veya toksik gazlar da sıklıkla ditiyokarbamatlar, izosiyanatlar, merkaptanlar, nitrürler, nitriller, sülfitler ve zayıf veya güçlü indirgeyici maddelerle reaksiyonlarla üretilir. Sülfitler, nitritler, tiyosülfatlar (H2S ve S03 vermek için), ditiyonitler (SO2) ve karbonatlarla ilave gaz üreten reaksiyonlar meydana gelebilir. Kimyasal reaksiyonları katalize edebilir (oranını artırabilir). Kaynama noktasına ısıtıldığında çok toksik ve aşındırıcı hidrojen florür gazı üretmek için ayrışır.

Tehlike
Cilt ile temasında ve solunduğunda aşırı derecede aşındırıcıdır.

Sağlık tehlikesi
Buharın solunması mukoza zarı üzerinde ciddi aşındırıcı etki yaratır. Yutma, şiddetli ağız ve mide yanıklarına neden olur. Sıvı veya buharla temas, ciddi göz ve cilt yanıklarına neden olur.

Yangın tehlikesi
Yanma Ürünlerinin Özel Tehlikeleri: Yangında tahriş edici hidrojen florür dumanları oluşabilir.

Endüstriyel kullanımlar
Hidroflorosilisik asit (H2SiF6) renksiz ila açık kahverengi bir sıvıdır. Ayrıca kalsiyum florür veya diğer florür içeren ürünlerden üretilir. Hidroflorosilik asit, bir dizi oksidik mineralin yüzdürülmesi sırasında birçok silikat için güçlü bir bastırıcıdır. Kalay, kolumbit ve tantalitin flotasyonu sırasında gang çökmesi için kullanılır.

Güvenlik profili
Deri altı yolla zehirlenme. Sktn, gözler ve mukoza zarları için aşındırıcı tahriş edicidir. Zehirli ve aşındırıcı dumanlar üretmek için su veya buharla reaksiyona girer. Ayrışmaya kadar ısıtıldığında toksik F- dumanları yayar. Ayrıca bkz. FLORİDLER.

Potansiyel maruziyet
Demleme ve şişeleme endüstrisinde sterilizasyon, kurşunun elektrolitik rafinasyonu için bir florosilik asit çözeltisi kullanılır; galvanik, sertleştirici çimento; küf ve diğerleri çıkarma.

Nakliye
UN1778 Florosilisik asit, Tehlike sınıfı: 8; Etiketler: 8-Aşındırıcı malzeme.

Uyumsuzluklar
Sulu çözelti, güçlü bir asittir. Su veya buharla reaksiyona girerek zehirli ve aşındırıcı hidrojen florür dumanları üretir. Uyumsuzdur ve şunlarla şiddetli reaksiyona girebilir: bazlar, alifatik aminler; alkanolaminler, alkilen oksitler; aromatik aminler; amidler, amonyak, amonyum hidroksit; kalsiyum oksit; epiklorohidrin, izo siyanatlar, oleum, organik anhidritler; sülfürik asit; güçlü oksitleyiciler; vinil asetat; Su. Cama, betona ve seramiğe tesir eder. Susuz form, neredeyse anında silikon tetraflorür ve hidrojen florüre ayrışır.

Atık Bertarafı
Solüsyondaki büyük miktarda soda külüne yavaşça ekleyin. Büyük hacimde su ile kanalizasyona deşarj


Sanayi Kullanımları

Tarım kimyasalları (böcek ilacı olmayan)
Korozyon inhibitörleri ve kireç önleyici maddeler
Alev geciktiriciler
Florlama ajanı
Oksitleyici / indirgeyici ajanlar
Kaplama ajanları ve yüzey işleme ajanları
Başka şekilde listelenmemiş işleme yardımcıları
Yüzey aktif maddeler
Su Florlama
Su Arıtma İşleme ve diğer çeşitli kullanımlar
Su arıtma
Su arıtma kimyasalı - florlama
su arıtma - florlama
su arıtma işlemi

Madde Tanımlayıcıları
 Ticari unvan
• Asit florosilikak
• Asit fluosilikası
• Asit fluosilikası
• Acido fluosilicico
• DİHİDROJEN HEKSAFLOROSİLİKAT (2-)
• Dihidrojen hekzaflorosilikat
• FLOROSİLİSİK ASİT
• FLOROSİLİSİK ASİT (H2SIF6)
• FLOROSİLİK ASİT% 40 (Solvay Özel Polimerler)
• FLUOSİLİSİK ASİT
• FSA
• Florosilisik Asit
• Florosilisik asit
• HEXAFLUORKIESELSAEURE
• HEXAFLOROSİLİSİK ASİT
• HFS
• HİDROFLOROSİLİSİK ASİT
• HİDROJEN HEKSAFLOROSİLİKAT
• Hekzaflorosilik Asit
• Hexafluosilicic asit
• Hidroflorosilik asit
• Hidrofluosilik asit
• Hidrofluosilik asit
• Hidrojen florosilikat
• Hidrojen hekzaflorosilikat
• Hidrojen hekzaflorosilikat
• Hidrosilikoflorik asit
• Hidrosilikoflororik asit
• KIESELFLUORWASSERSTOFFSAEURE
• SİLİKAT (2-), HEXAFLORO-, DİHİDROJEN
• Kum asidi
• Silikat (2-), hekzafloro-, dihidrojen
•  Silisik asit
• Silikoflorik Asit
• Silikoflorik asit
• Silikoflorür
• Silikoflorür
• Silikon hekzaflorür dihidrit
• Silikon hekzaflorür dihidrit
• florosilik asit
• fluosilik asit
• heksaflorosilik asit
• heksaflorosilik asit
• hidrofluosilik asit
• kwas fluorokrzemowy
• silikoflorik asit

Heksaflorosilisik asit
Florosilik asit
16961-83-4
Dihidrojen heksaflorosilikat
Silikat (2-), hekzafloro-, dihidrojen
MFCD00036289
heksaflorosilikon (2 -); hidron
Fluosilik asit, ağırlıkça% 25 sulu çözelti
UNII-53V4OQG6U1
heksaflorosilikon (2-); hidron
Kieselfluorwasserstoffsaure
53V4OQG6U1
DTXSID2029741
hekzakis (floranil) silikon (2-); hidron
DB-064742
FT-0626488
A811126
Q411250
J-521443


FLUOSİLİK ASİT
tetrafluorosilan; dihidroflorür
Hidrojen heksaflorosilikat
Florosilik asit çözeltisi
Kum asidi
Silikoflorik asit
Hexafluosilicic asit
Hidrofluosilik asit
Hidroflorosilik asit
Hidrosilikoflorik asit
FLOROSİLİK ASİT
H2SiF6
AKOS015903679
Florosilik asit, suda% 22-25
Fluosilik asit, purum,% 33,5-35
GF10035
SİLİKAT (2 -), HEXAFLORO-, DİHİDROJEN
Florosilik asit solüsyonu, AR,% 30.0-32.0
Florosilik asit çözeltisi, GR,% 30.0-32.0
Florosilik asit solüsyonu, 20-25 wt. H2O'da%

Kimyasal tehlikeler
Isındığında bozunur. Bu, hidrojen florür içeren zehirli dumanlar üretir. Sudaki çözelti güçlü bir asittir. Bazlarla şiddetli tepki verir ve aşındırıcıdır. Su ve buharla reaksiyona girer. Bu zehirli ve aşındırıcı dumanlar üretir. Cam ve seramiklere tesir eder. Birçok metale saldırır. Bu, yanıcı / patlayıcı gaz üretir (hidrojen - bkz. ICSC 0001). Bu madde (susuz form) neredeyse anında silikon tetraflorür ve aşındırıcı ve toksik hidrojen florüre ayrışır.

Yalnızca sulu çözelti olarak pazarlanmaktadır.
% 60-70 çözelti için katılaşma noktası: yaklaşık 19 ° C'de katılaşır ve kristalli bir dihidrat oluşturur.
Diğer erime noktaları: <-30 ° C (% 35 çözelti).
% 61'lik bir çözelti için bağıl yoğunluk 1.46 ve% 35'lik çözelti için 1.38'dir.
% 35'lik bir çözelti için buhar basıncı yaklaşık 3 kPa'dır.
Akciğer ödeminin semptomları genellikle birkaç saat geçene kadar ortaya çıkmaz ve fiziksel eforla şiddetlenir. Dinlenme ve tıbbi gözlem bu nedenle önemlidir.
Literatürde bozunma sıcaklığı bilinmemektedir.
Uygun bir inhalasyon tedavisinin bir doktor veya yetkili bir kişi tarafından derhal uygulanması düşünülmelidir.


Hidroflorosilisik asit veya H2SiF6, tehlike oluşturan özelliklere ve belirli depolama endişelerine sahip olduğu için zorlu bir kimyasaldır. Su arıtmada yaygın kullanımı nedeniyle, bu kimyasalı saklamanın yanlış bir şekilde taşıdığı risklerin farkında olmanız önemlidir.


Hidroflorosilik Asit Nasıl Kullanılır
Bu kimyasal için en yaygın tartışılan uygulama, su arıtma tesislerindeki su florlamadır. Bu işlem periodontal problemlerin önlenmesine yardımcı olur ve içme suyuna eklenir. Aynı amaçla içme suyuna eklenen diğer bir yaygın kimyasal sodyum florürdür, ancak beş kat daha pahalı olabilir. Bununla birlikte, hidroflorosilisik asidin depolanması daha tehlikeli olabilir, bu nedenle güvenilir ve güvenli bir depolama çözümüne sahip olmak önemlidir.

FSA'nın bir başka kullanımı da camı aşındırmaktır; Kimyasalın son derece aşındırıcı doğası, bu istenen uygulama için etkilidir. Bir sonraki bölümde depolama seçeneklerine değineceğiz, ancak bu nedenle cam veya fiberglas tanklar, amaç "değil" cam yemek olduğunda iyi depolama çözümleri değildir.

Hidroflorosilik asit, porselen içerebilen tuzların üretiminde de kullanılmaktadır.


Depolama Sorunları ve Çözümleri
Hidroflorosilik asit, yerel su arıtma tesisinizdeki en tehlikeli kimyasaldır. Buharlaştığında hidrojen florür salabilir, aşındırıcıdır ve solunduğunda akciğerlere zarar verebilir, bu da yanlış depolandığında özellikle tesis çalışanları için tehlikeli hale getirir.

FSA ayrıca yanıcı bir hidrojen gazı üretmek için metallerle olumsuz etkileşime girer, bu da paslanmaz çelik kimyasal depolama tankının uygun bir seçenek olmadığı anlamına gelir. Cama saldırır, betonu yer ve ciddi bir depolama endişesi oluşturur. Rotomolded plastik uygun bir depolama seçeneği haline gelmeden önce, genellikle depolama için reçine açısından zengin bir örtü ile inşa edilen fiberglas tanklar kullanılıyordu. Bununla birlikte, reçine bakımından zengin örtü, uyumsuz fiberglas (kesilmiş cam) yapının kendisinden genellikle yalnızca ⅛ ”kimyasal bariyer koruması sağlar. FSA camı yediğinden, FSA'yı camdan yapılmış yapısal bir destek kabından yalnızca minimum güvenlik bariyeri sağlayan bir yerde saklamak aslında inanılmaz derecede tehlikelidir.

Bu durumlarda, yüksek yoğunluklu çapraz bağlı polietilen (XLPE) depolama tankı en güvenli seçenektir ve bir sorun olması durumunda ikincil muhafazalı birini seçmek en iyisidir. Doğrusal polietilen (HDPE) ile fermuarın açılması (veya tankın yan tarafının yıkıcı bir şekilde yırtılması) mümkündür, ancak XLPE ile tankın yapısal bütünlüğü tehlikeye girse bile dayanacaktır. Poly Processing'in SAFE-Tank® gibi ikincil muhafazalı bir XLPE tankı, kimyasalın yanı sıra birincil tanktan pompaya geçiş çıkışını da içerebilir. Aksi takdirde sağlam bir sistemin en savunmasız parçası olan armatürünüzü içermemek, ilk etapta muhafazaya sahip olmamak gibidir. Diğer bir seçenek de, pompa fitingini, armatür arızalandığında kimyasalın çıkamayacağı bir yere tankın üstüne yerleştirmektir. Ancak bu, pompalama sisteminde özel tasarım gerektirir.

Çoğu Amerikan su arıtma tesisinde meydana gelen florlama popülaritesi ile, tank üreticisinden NSF-61 sertifikasına sahip bir tank (ve özellikle hidroflorosilik asit için ve sadece içme suyu için değil) dahil edilmelidir. XLPE tankları bu sertifika ile mevcuttur. NSF, İzin Verilen Maksimum Düzeylere (MAL) göre kesin kimyasala göre sertifika sunduğundan, NSF61 tanımlamalarının test edilen spesifik kimyasallar (yalnızca su değil) için olduğundan her zaman emin olun.

Hidroflorosilik Asit Depolama Tankı Gereksinimleri
Tankın, düzenli pompa incelemesi için pompa kızağını izole etmek için güvenilir bir kapatma vanasına ihtiyacı vardır. İşçileri FSA'nın zararlı etkilerine maruz bırakabilecek ve kırılabilecek hat korozyonu olmadığından emin olmak için tankın pompasının yılda birkaç kez kontrol edilmesi gerekir.

Tam tahliyeli bir XLPE tankı, aynı zamanda FSA'nın depolanması için iyi bir seçimdir, çünkü birikintilerin birikmesini önlemeye yardımcı olabilir. FSA'nın depolanmasıyla ilgili bir endişe, yukarıda tartışıldığı gibi arsenik birikmesi ve birikmiş kurşundur. Bazı yerel EPA yetkilileri, bu nedenle bu tanklar için özel kaldırma prosedürleri belirleyecektir. Bununla birlikte, dolu bir boşaltma tankı, bu birikintilerin oluşmasını önleyecektir.

Tam tahliyenin tankın dibiyle aynı hizada olduğundan ve yukarıda tartışılan nedenlerden dolayı metal ek parçalar içermediğinden emin olun. Silika çökelmesi, seyreltme aralıkları 10: 1'in üzerine çıkarsa potansiyel bir sorundur. Yine, tam bir tahliye veya IMFO bağlantısı bu endişeyi ortadan kaldıracaktır.

Korozyon Bir Sorun Mudur?
Pek çok operatör, konsantre H2SiF6 depolamadan salınan HF gazı konusunda endişe duymaktadır, çünkü su floridasyonu boruları aşındıracaktır. Bununla birlikte, su floridasyonu için sıcaklıklar ve konsantrasyonlar, FSA'nın florür, hidrojen ve silikaya (kum) tam ayrışmasını sağlar ve HF üretemez. Silikatlar aslında su korozyonu için stabilizatör olarak kullanılır. Bu nedenle, çözümde korozyon bir sorun değil, havalandırma sorunudur.

FLOROSİLİK ASİT

florosilik asit
florosilik asit ...%
Fluosilik asit
Heksaflorosilisik asit
heksaflorosilik asit


Çevrilen isimler
...% fluorsilicio rūgštis (lt)
asit florosilikik…% (ro)
asit florosilika à…% (fr)
asit fluosilicique ...% (fr)
acido fluosilicico ...% (o)
Fluoripiihappo ...% (fi)
Fluororänihape…% (et)
fluorosilicijska kiselina ...% (saat)
fluskiselsyre ...% (da)
heksafluorkiselsyre ...% (hayır)
heksafluorosilicijeva kislina ...% (sl)
hexafluorkiezelzuur (nl)
Hexafluorokieselsäure ...% (de)
hexafluorokiselsyra ...% (sv)
hexafluorosilicato de hidrógeno ...% (es)
hidrogen-szilícium-hexafluorid…% (hu)
hydrogensilicimhexafluorid ...% (da)
hydrogensilisiumfluorid ...% (hayır)
Kieselfluorwasserstoffsäure ...% (de)
kiezelfluorwaterstof ...% (nl)
kwas heksafluorokrzemowy ...% (pl)
kyselina hexafluorokremičitá ...% (sk)
kyselina hexafluorokřemičitá .....% (cs)
 …% Fluorsilīcijskābe (lv)
ácido fluorosilícico (es)
ácido fluorossilícico em solução ...% (pt)
εξαφθοροπυριτικό οξύ ...% (el)
флуоросилициева киселина% (bg)

CAS isimleri
Silikat (2-), heksafloro-, hidrojen (1: 2)

IUPAC isimleri
Dihidrojen heksaflorosilikat
dihidrojen heksaflorosilikat
Dihidrojen heksaflorosilikat (2-)
florosilik asit
Florosilik asit
florosilik asit ...%
H2SiF6
hexafluoro-kovasav
hekzaflorosilkat
heksaflorosilikat
Heksaflorosilisik asit
heksaflorosilik asit
Heksaflorosilisik asit
heksaflorosilik asit
heksaflorosilik asit-
heksaflorosilikon (2-); hidron
heksaflorosilikon (2 -); hidron


Ticari isimler
Asit florosilikak
Asit fluosilikası
Acido fluosilicico
Dihidrojen heksaflorosilikat
DİHİDROJEN HEKSAFLOROSİLİKAT (2-)
FLOROSİLİK ASİT
Florosilik Asit
Florosilik asit
florosilik asit
FLOROSİLİK ASİT (H2SIF6)
FLOROSİLİK ASİT% 40 (Solvay Özel Polimerler)
FLUOSİLİK ASİT
fluosilik asit
ÖSO
HEXAFLUORKIESELSAEURE
HEXAFLOROSİLİK ASİTHekzaflorosilisik Asit
heksaflorosilik asit
Hexafluosilicic asit
HFS
HİDROFLOROSİLİSİK ASİT
Hidroflorosilik asit
Hidrofluosilik asit
hidrofluosilik asit
Hidrojen florosilikat
HİDROJEN HEKSAFLOROSİLİKAT
Hidrojen heksaflorosilikat
Hidrosilikoflorik asit
Hidrosilikoflororik asit
KIESELFLUORWASSERSTOFFSAEURE
kwas fluorokrzemowy
Kum asidi
SİLİKAT (2-), HEXAFLORO-, DİHİDROJEN
Silikat (2-), hekzafloro-, dihidrojen
Silisik asit
Silikoflorik Asit
Silikoflorik asit
silikoflorik asit
Silikoflorür
Silikon heksaflorür dihidrit

Diğer isimler

Kortikotropin
Dihidrojen heksaflorosilikat
FKSFluosilisik asit (6CI)
Florosilik asit
Heksaflorosilisik asitHekzaflorosilisikat (2 -), dihidrojen
Hexafluosilicic asit
Hidroflorosilik asit
Hidrofluosilik asit
Hidrojen heksaflorosilikat
Hidrojen heksaflorosilik
Hidrosilikoflorik asit
Kum asidi
Silikat (2 -), hekzafloro-, dihidrojen (8CI, 9CI)
Silisik asit (H2SiF6)
Silikoflorik asit
Silikoflorür Silikon hekzaflorür dihidrit
UN1778 (DOT)


Heksaflorosilisik Acid, metal üretimi gibi oksijene duyarlı uygulamalarda kullanım için suda çözünmeyen bir Silikon kaynağıdır. Son derece düşük konsantrasyonlarda (ppm), florür bileşikleri sağlık uygulamalarında kullanılır.
Florür bileşikleri ayrıca sentetik organik kimyada önemli kullanımlara sahiptir. Genellikle metal alaşımı ve optik biriktirme için de kullanılırlar. Bazı florür bileşikleri nano ölçekte ve ultra yüksek saflıkta formlarda üretilebilir

Reaktivite Profili
FLOROSİLİK ASİT, toksik hidrojen florür dumanları açığa çıkarmak için güçlü asitlerle (sülfürik asit gibi) reaksiyona girebilir.
FLOROSİLİK ASİT cama ve silika içeren malzemelere saldırır.
FLOROSİLİK ASİT, kimyasal bazlarla ekzotermik olarak reaksiyona girer (örnekler: aminler, amidler, inorganik hidroksitler).
FLOROSİLİK ASİT, metali çözmek ve hidrojen ve / veya toksik gazları serbest bırakmak için demir ve alüminyum dahil olmak üzere aktif metallerle reaksiyona girer.
FLOROSİLİK ASİT, belirli alkenlerde polimerizasyonu başlatabilir.
FLOROSİLİK ASİT, gaz halindeki hidrojen siyanürü serbest bırakmak için siyanür tuzları ve bileşikleriyle reaksiyona girer.
FLOROSİLİK ASİT yanıcıdır ve / veya toksik gazlar sıklıkla ditiokarbamatlar, izosiyanatlar, merkaptanlar, nitritler, nitriller, sülfitler ve zayıf veya güçlü indirgeyici maddelerle reaksiyonlar sonucu oluşur. Sülfitler, nitritler, tiyosülfatlar (H2S ve S03 vermek için), ditiyonitler (SO2) ve karbonatlarla ilave gaz üreten reaksiyonlar meydana gelebilir. Kimyasal reaksiyonları katalize edebilir (oranını artırabilir). Kaynama noktasına ısıtıldığında çok toksik ve aşındırıcı hidrojen florür gazı üretmek için ayrışır.

DİHİDROJEN HEKSAFLOROSİLİKAT
DİHİDROJEN HEKSAFLOROSİLİKAT (2-)
FLOROSİLİK ASİT
FLOROSİLİK ASİT
FLOROSİLİK ASİT (H2SIF6)
FLUOSİLİK ASİT
HEXAFLOROSİLİK ASİT
HEXAFLOSİLİK ASİT
HİDROFLOROSİLİSİK ASİT
HİDROFLOSİLİK ASİT
HİDROFLOSİLİK ASİT
HİDROJEN HEKSAFLOROSİLİKAT
HİDROJEN HEKSAFLOROSİLİKAT (H2SIF6)
KUM ASİTİ
SİLİKOFLORİK ASİT
SİLİKON HEKZAFLORÜR DİHİDRİT

• SİLİKOFLORİK ASİT
• HİDROJEN HEKSAFLOROSİLİKAT
• HİDROFLOROSİLİSİK ASİT
• HİDROFLOSİLİK ASİT
• HİDROSİLİKOFLORİK ASİT
• HEXAFLOROSİLİK ASİT
• HEXAFLOSİLİK ASİT
• FLUOSİLİK ASİT
• Florosilik asit% 35
Florosilik asit
Heksaflorosilisik asit
Fluosilik asit
• KORTİKOTROPİN
• KORTİKOTROPİN (İNSAN)
• DİHİDROJEN HEKSAFLOROSİLİKAT
• Hexafluorkieselsure
• Silikat (2-), hekzafloro-, dihidrojen
• florosilik asit solüsyonu
• Heksaflorosilisik asit,% 23 sulu çözelti
• FLOROSİLİK ASİT: SUDA% 35
• HEXAFLOROSİLİK ASİT:% 35 W / W SULU ÇÖZELTİ
• ACTH
• ACTH 1-39
• ACTH (1-39), İNSAN
• ADRENOKORTİKOTROPİK HORMON (1-39) (İNSAN)
• ADRENOKORTİKOTROPİK HORMON İNSAN
• Heksaflorosilisikacid% 23 solüsyon
• Kum asidi
• FLOROSİLİK ASİT, 20-25 WT. SUDA% ÇÖZÜM
• Heksaflorosilisik asit% 25
• HEXAFLOROSİLİK ASİT% 34, SAF
• HEXAFLOROSİLİK ASİT% 34, TEKNİK
• HEXAFLOROSİLİK ASİT YAKLAŞIK. % 25
• Heksaflorosilisik asit,% 35 sulu çözelti
• Florsilik asit
• Heksaflorosilisikacid, 2a sulu çözelti
• FLOROSİLİK ASİT,% 20-25 ÇÖZELTİ
• Silikoflorik asit (% 35)
• Silikat (2-), hekzafloro-, hidrojen (1: 2)
• Florosilik asit, Heksaflorosilik asit, Hidrojen hekzaflorosilikat
• Hekzaflorosilik asit
• FLOROSİLİK ASİT
• FLOROSİLİK ASİT
• KORTİKOTROPİN A
• Hekzaflorosilik asit,% 35 a / a aq. soln.
• Hekzaflorosilik asit,% 23 a / a aq. soln.
• Silikoflorik asit: (Florosilik asit)
• FLOROSİLİK ASİT, suda% 25
• SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN -GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
• Hekzaflorosilik Asit w / w aq. Soln.
• Florosilik asit% 35
• Florosilik asitler
• Hekzaflorosilik asit (HFS)
• Fluosilik asit, ağırlıkça% 25 sulu çözelti 500GR
• Fluosilicic asit,% 25 WT sulu çözelti
• Hidrosilikoflorik asit
• FLOROSİLİK ASİT, suda% 22-25

Asit florosilikliği [Fransızca]
Acido fluosilicico [İtalyanca]
Dihidrojen heksaflorosilikat [ACD / IUPAC Adı]
Dihidrogenhexafluorosilicat [Almanca] [ACD / IUPAC Adı]Hekzaflorosilisikat de dihidrojen [Fransızca] [ACD / IUPAC Adı]Hekzaflorosilisik asit [Wiki]
Silikat (2-), hekzafloro-, dihidrojen [ACD / Endeks Adı]
Asit fluosilikası [Fransızca]
Caswell No. 463
CCRIS 2296
DİHİDROJEN HEKSAFLOROSİLANEDİUİT
Dihidrojen heksaflorosilikat (2-)
Dihidrojen heksaflorosilikat (2-)
Florosilik asit
Florosilik asit [UN1778] [Aşındırıcı]
Fluosilik asit
Hexafluorokieselsaeure [Almanca]
Hexafluorokiezelzuur [Felemenkçe]Hekzaflorosilisik asit
Heksaflorosilisik asidöz
heksaflorosilikon (2-); hidron
Hexafluosilicic asit
HSDB 2018
Hidroflorosilik asit
Hidrofluosilik asit
Hidrojen heksaflorosilikat
Hidrosilikoflorik asit
Kiezelfluorwaterstofzuur [Hollandaca]
MFCD00036289 [MDL numarası]
NSC 16894
Kum asidi
SİLİKOFLORİK ASİT
Silikoflorür
Silikon heksaflorür dihidrit
UN1778
氟 硅酸 [Çince]
Heksaflorosilisik asit, H2SiF6'nın ayrışmasını ve hidrolizini önlemek için önemli bir konsantrasyonda HF (aq) içeren konsantre bir çözelti olarak satılır.


Avrupa florosilisik asit pazar büyüklüğünün 2019'da 52,38 milyon ABD Doları olacağı tahmin edildi ve 2020'den 2027'ye bileşik yıllık büyüme oranında (CAGR)% 4,5 oranında genişlemesi bekleniyor. alüminyum, benzin ve soğutucuların üretimi için endüstriyel hammadde - pazarın büyümesini hızlandırması bekleniyor. florosilisik asit, fosfatlı gübre üretim sürecinden elde edilen önemli bir yan üründür; burada sülfürik asit, fosfat kayası ile işlenir. Bu madde, birçok endüstride yaygın olarak kullanılmaktadır ve başlangıçta çeşitli herbisitler, soğutucular, benzin, ilaçlar, mutfak eşyaları, elektrikli bileşenler, plastik ürünler ve diğerlerini formüle etmek için tüketilmektedir.

florosilisik asit, çeşitli endüstrilerde çok sayıda uygulama bulur; bununla birlikte, birincil uygulaması hidrojen florürün sentezidir. Bununla birlikte, Avrupa'da, suda kullanılan florlama ajanlarına ilişkin katı düzenlemeler nedeniyle, kimyasal, hidrojen florür, alüminyum florür ve diğerlerinin formüle edilmesinde ana uygulamasını bulur.

florosilisik asit ile beslenen başlıca uygulama endüstrilerinden biri olan hidrojen florür, soğutucu akışkanlarda kullanılan hidroflorokarbonların üretiminde kullanılmaktadır. florosilisik asit tüketimi, soğutucu akışkanlara olan artan talep tarafından yönlendirilmektedir. Avrupa ülkeleri, FMCG şirketlerinin yüksek penetrasyonunu pazar alanına yansıtmış ve bu da bölgedeki çeşitli endüstriyel soğutucuların paralel olarak yüksek tüketimiyle sonuçlanmıştır. Paketlenmiş gıda ürünlerinin, konserve içeceklerin ve daha fazlasının yüksek satışları, tüm Avrupa ülkelerinde birden fazla süpermarket ve organize bakkaliye inşa edilmesine neden oldu. Bu, soğutucu akışkanlara olan talebin artmasına ve dolayısıyla Avrupa'da daha yüksek hidrojen florür talebine neden oldu.


Eş anlamlı:
 dihidrojen heksaflorosilisikat
 heksaflorosilisik asit
 heksaflorosilikon (2 -); hidron
 hidrojen heksaflorosilikat
 silikat (2-), heksafloro-, dihidrojen


florosilisik asit

Ajan adı
florosilisik asit

Alternatif isim
Fluosilik asit

CAS numarası
16961-83-4

Formül
F6-Si.2H

Ana Kategori
Zehirli Gazlar ve Buharlar
florosilisik asit formülü grafik gösterimi

Eş anlamlıFluosilisik asit; Acide fluorosilicique [Fransızca]; Acide fluosilicique [Fransızca]; Acido fluosilicico [İtalyanca]; Dihidrogen hekzaflorosilisikat; Dihidrojen heksaflorosilisikat (2-); FKS; Hexafluorokieselsaeure [Almanca]; Hexafluorokieselsaiure [Almanca]; Hexafluorokiezelzuur [Hollandaca]; Heksaflorosilisik asit; Hexafluosilicic asit; Hydrofluorosilicic asit; Hidrofluosilik asit; Hidrojen heksaflorosilisikat; Hydrosilikofluoric asit; Kiezelfluorwaterstofzuur [Hollandaca]; Kum asidi; Silikat (2-), heksafloro-, dihidrojen; Silikofluorik asit; Silikoflorür; Silikon heksaflorür dihidrür; Silikat (2-), heksafloro-, hidrojen (1: 2); [ChemIDplus] UN1778

Kategori
Asitler, İnorganik

Açıklama
Ekşi, keskin kokulu renksiz sıvı; [HSDB] Sulu çözelti (<=% 35 florosilisik asit): Berrak açık sarı sıvı; [Aldrich MSDS]

Kaynaklar / Kullanımlar
Kimyasal ara ürün, dezenfektan, su florlama ajanı, ahşap koruyucu, duvarcılık ve seramik sertleştirici ve cam katkı maddesi olarak kullanılır; aynı zamanda postları ve derileri işlemek, kromu elektroliz etmek ve kurşunu elektrolitik olarak rafine etmek için kullanılır; [HSDB] Teknik boyalarda, yağ kuyusu asitleştirmede ve tekstil ürünlerinden küf, pas ve lekeleri çıkarmak için kullanılır; [NTP]

Yorumlar (değiştir | kaynağı değiştir)
Cildi aşındırıcı; [Hızlı CPC] Yüksek inhalasyon maruziyeti akciğer ödemine neden olabilir; Aerosolün kronik yutulması veya solunması sonrasında floroz potansiyeli; [ICSC] Kesinlikle sulu bir çözelti olarak pazarlanmaktadır; Susuz form, neredeyse anında silikon tetraflorür ve hidroflorik aside ayrışır; % 60-70 solüsyonlar yaklaşık 19 ° C'de katılaşır ve bir kristalli dihidrat oluşturur; [Merck Index] Havadaki dumanlar; Su ile karıştırıldığında ısı ve aşındırıcı dumanlar açığa çıkarır; [CAMEO] Gözlerde ve deride yanıklara neden olur (birkaç dakikalık temastan sonra ikinci derece); Kronik maruz kalma tehlikeleri arasında osteofloroz, solunum yetmezliği ve karaciğer ve böbreklerde yaralanma; [CHRIS] Kronik maruz kalma kemikte değişikliklere, mukoza zarlarının aşınmasına, öksürmeye, şoka, akciğer ödemine, floroza, komaya ve ölüme neden olabilir; [NTP] Yanıklara neden olur; Soluma, üst solunum yollarında ve akciğerlerde aşındırıcı yaralanmalara neden olabilir; Yutulduğunda toksik; [Aldrich MSDS] Bkz. "FLORİTLER".

HEXAFLOROSİLİK ASİT UYGULAMALARI
Ahşap Koruyucular
Galvanik
Kürk Pansuman ve Boyama
Cam İmalatı
Deri Tabaklama ve İşleme
Metal Hazırlama ve Dökme
Boyama (Pigmentler, Bağlayıcılar ve Biyositler)
Petrol Üretimi ve Rafineri
Kanalizasyon ve Atık Su Arıtma
Dezenfektanlar ve Biyositler


florosilisik Asit, Heksaflorosilisik Asit, Flüosilisik Asit veya FSA da fosforik asit endüstrisinin normalde nötralize edilen ve fosfojips ile veya özel bir alanda bertaraf edilen istem dışı bir yan ürünüdür.

 

FSA çok faydalı bir kullanım olabilir, su floridasyonunda su arıtma endüstrisinde normal bir uygulama olarak kullanılabilir, ayrıca her ikisi de alüminyum endüstrisinde erime noktasını düşürmek için kullanılan Sodyum Florür veya Alüminyum Florür üretiminde kullanılabilir. Alüminyum cevheri.

 

FSA aynı zamanda fosforik asit endüstrisinde oldukça aşındırıcı Hidroflorik Asiti (HF) nötralize etmek için kullanılabilen değerli bir ürün olan aktif silika kaynağı olabilir, diğer birçok endüstride de kullanılabilir.


Eşanlamlılar: Hidroflorosilisik Asit, Hidrofluosilisik Asit, Hidrtosilikofluodiyer Asit, Florosilisik Asit, Silikoflorik Asit, Florosilisik Asit Hammaddeleri Kalsiyum florür, Hidroflorik asit, Silikon dioksit, Sülfürik asit, Selit Hazırlama Ürünleri, Amonyum florodyum florosilikat, Sülfürik asit, Selit Hazırlama Ürünleri , Sodyum tetrafloroborat, MAGNEZYUM HEKSAFLOROASETİLASETONAT DİHİDRAT, Kromik asit, Potasyum florosilikat, Magnezyum florosilikat, Magnezyum heksaflorosilikat heksahidrat, Sodyum tripolifosfat, Alüminyum heksaflorür, Sodyum tripolifosfat, Alüminyum flüorür, Sodyum florosilikat, KUPRİK FLOİLİK FLORİK 1 FLORSPAR VE SU FLORİDASYON KİMYASALLARI Fluorspar (CaF2), flor içeren en önemli mineraldir. Dünya çapında fluorspar tüketiminin yaklaşık% 52'si hidroflorik asit üretimi için başlangıç ​​malzemesi olarak kullanılmaktadır; alüminyum endüstrisinde flukslama maddesi olan alüminyum florür için% 18 daha kullanılır; ve çelik endüstrisinde cürufun akışkanlığını iyileştirmek için bir akış olarak çelik endüstrisi için% 25.
Fluorspar, mineral floritin (kalsiyum florit) ticari adıdır ve florin ana hammadde kaynağıdır.
Avrupa Birliği'nin fluorspar tüketiminin% 25'i, başta İspanya olmak üzere AB üye ülkeleri tarafından üretilmektedir.
Çin gibi eyaletlerden çok daha büyük bir miktar ithal ediliyor. 2 Fluorspar yatakları, temelde kurşun, gümüş veya çinko gibi değerli ve baz metal cevherlerinin bir yan ürünüdür.
Fluorspar birikintileri mineral bileşimine göre değişir ve saf değildir.
Çok miktarda silika içerirler.
Küçük miktarlarda nadir toprak elementleri (REE), stronsiyum ve diğer elementler fluorspar kristal yapısı içindeki kalsiyumun yerini alabilir. Fluorspar, alüminyum, benzin, izolasyon köpükleri, soğutucular, çelik ve uranyum yakıt gibi ürünlerin üretiminde doğrudan veya dolaylı olarak kullanılır.
Floropolimerler, kloroflorokarbonlar (CFC'ler), hidrokloroflorokarbonlar (HCFC'ler) ve hidroflorokarbonlar (HFC'ler) dahil olmak üzere Florokarbon kimyasallarının üretiminde kullanılır. CFC'ler, HCFC'ler, HFC'ler ve Hidroflorik asit (HF).

HF, dielektrikler, metalurji, ahşap koruyucular, herbisitler, ağız gargaraları, diş macunları, plastikler ve su floridasyonunda kullanılan bir dizi flor kimyasalının üretiminde hammadde olarak kullanılır.
En yaygın son ürünlerinden biri, su floridasyonunda kullanılan hidrofluosilik asit olarak da bilinen florosilik asit veya heksaflorosilik asittir.
HF, neredeyse tüm organik ve inorganik flor içeren kimyasalların üretimi için birincil hammaddedir ve aynı zamanda alüminyum ve uranyumun işlenmesinde önemli bir bileşendir.
Florspat tüketiminin geri kalan kullanımı, çelik yapımında, demir ve çelik dökümhanelerinde, birincil alüminyum üretiminde, cam üretiminde, emayelerde, kaynak çubuğu kaplamalarında, çimento üretiminde ve Heksaflorosilisik asit üretimi gibi diğer kullanımlar veya ürünlerde bir akış olarak kullanılmaktadır. Bitmiş ürünlerde kurşun ve arsenik gibi eser elementler mevcuttur. Heksaflorosilik asit, H2SiF6'nın ayrışmasını ve hidrolizini önlemek için önemli bir konsantrasyonda HF (aq) içeren konsantre bir çözelti olarak satılır.
Kuzey Amerika'da birçok belediye yetkilisi, florspat veya fosfat kayası ile reaksiyona girmek için asit yıkayıcılardan geri kazanılan sülfürik asidi kullanarak aynı ürünü tedarik etmektedir.

Nasıl üretilir?
Fluorspar, hidroflorik asit yapmak için kullanılmadan önce, ham cevher fiziksel olarak konsantre edilmeli ve saflaştırılmalıdır. Fluorspar ezilir, öğütülür ve köpük yüzdürme ile saflaştırılır. İlk olarak kurşun ve çinko sülfitler ayrılır ve fluorspar sülfürik asit oluşturan hidroflorik asit gazı (HF) ile işlenir.
Asit dereceli fluorspar tipik olarak en az yüzde 97 kalsiyum florürün yanı sıra silika, karışık metal oksitler ve eser miktarda arsenik içerir.
HF gazı daha sonra soğutulan, fırçalayarak saflaştırılan ve yoğunlaştırılan gazı içeren bir saflaştırma sürecini başlatır.
Ham ürün seyreltilebilir ve yaklaşık yüzde 70 hidroflorik asit çözeltisi olarak satılabilir veya kalan suyu uzaklaştırmak ve safsızlıkları daha da azaltmak için damıtılabilir ve tipik olarak yüzde 37 ila 42'lik bir konsantrasyona kadar heksaflorosilik asit (hidroflorosilik asit) olarak satılabilir. .
Üretim süreci, kurşun ve çinko sülfitlerden, kullanılmış yüzdürme reaktiflerinden ve aşındırıcı proses atık suyundan oluşan atık atıkları üretir.

Başvurular
Çimento
Seramikler
Kimyasal ara madde
Galvanik
Çamaşır ekşi
Cevher çıkarma
Şişeleme ekipmanlarının sterilizasyonu
Su florlama

Hidroflorosilik asit, belirli bir tesiste en tehlikeli kimyasal olabilir. Buharlaşma durumunda, son derece aşındırıcı olan ve solunduğunda akciğerlere zarar verecek olan hidrojen florür salgılar. Ek olarak, hidroflorosilik asit, metallerle etkileşime girer ve yanıcı bir hidrojen gazı üretir. Potansiyel korozyon veya sızıntı ile birlikte bu tehlikeler, çalışan personel ve ekipmana anında zarar verebilir. Hidroflorosilik asitle çalışmak için doğru pompayı seçerken güvenlik önlemleri önemli bir husus olmalıdır.


Oda sıcaklığında hidroflorosilik asit pompalarken, Polipropilenden yapılmış contasız bir manyetik tahrikli kimyasal pompanın seçilmesi şiddetle tavsiye edilir. Hidroflorosilik asit son derece aşındırıcıdır ve her türlü metalle etkileşime girer. Kapsüllenmiş Pervane, Karbon Burç ve Viton O-ring her türlü sızıntıyı önleyecek ve çalışan personelinizin ve ekipmanınızın güvenliğini sağlayacaktır.


Hydrofluorosilicic Acid; Hydrosilikofluoric asit;
Kum asidi; Silikofluorik asit; Fluosilicic asit; Hydrofluorosilicic asit; Hidrofluosilik Asit; Heksaflorosilisik asit; Dihidrogen hekzaflorosilikat;氟 硅酸; Hexafluorokieselsäure (Hollandaca); ácido Heksaflorosilisiko (İspanyolca); Acide hexafluorosilicique (Fransızca); Silikofluorik asit; Silikoflorür; Silikon heksaflorür dihidrür; Florosilik asit; H2SiF6; Hidrojen heksaflorosilikat;


Florosilisik asit, H2SiF6 kimyasal formülasyonunu içeren yarı saydam, saman rengi, aşındırıcı bir sıvıdır. Yüksek endüstriyel saflıkta asit içeren modern kauçuk astarlı ekipmanlarda üretilmektedir. Florosilik asit, florür hidrojen ve fosforik asit senteziyle oluşan organik bir sıvıdır. Genellikle belediye şirketleri ve diş macunu tarafından sudaki florür miktarını kontrol etmek için su floridasyonu için kullanılır. Florür seviyelerini korumak diş çürümesini önlemeye yardımcı olur.

PAZAR DİNAMİKLERİ

Su floridasyonu, elektrokaplama ve iyi asitleştirici yağlar için artan tüketici talebi, florosilik asit pazarının boyutunu artırabilir.
Florür miktarını kontrol etmek için su arıtma sürecinde belediye şirketleri tarafından kullanılır.Hekzaflorosilisik asit, ürün talebini tetikleyebilen krom içermeyen yüzey pasivasyonuna neden olduğu için metal yüzey işleme proseslerinde yaygın olarak kullanılmaktadır.
Dahası, tekstil ürünlerindeki leke ve pasın çıkarılması için tekstil endüstrisinden gelen ürünlere yönelik artan talep, hidroflorosilik endüstrisinin büyümesini tetikleyecektir.
Ayrıca ürün, endüstriyel tekstil işlemede veya çamaşırhane hizmetlerinde pH ayarlaması için kullanılır ve böylece ürün büyümesini sağlar. Hidroflorosilik asit, diş macunu, gargara, diş ipi ve diş beyazlatma gibi ağız bakım ürünlerinde yaygın olarak kullanılmaktadır. Diş eti iltihabı, takma diş tahrişi ve diş eti kanaması gibi ağız rahatsızlıkları konusunda artan tüketici bilincinin endüstri gelişimini hızlandırması muhtemeldir.
Zayıf noktaları ve açıkta kalan kökleri güçlendirir ve ürüne olan talebi artırabilecek erken diş çürümelerini önlemeye yardımcı olur.
Dolayısıyla tüm bu faktörlerin ürün talebini olumlu yönde etkilemesi beklenmektedir.


Su florlaması, batı dünyasının çoğunda uygulanan önemli bir önleyici tedbirdir.
Bu, bazı hidroksiapatit Ca5 (PO4) 3OH'nin insan diş minesinin yerini floroapatit, Ca5 (PO4) 3F - çürümeye karşı önemli ölçüde daha dirençli bir madde ile değiştirilmesine neden olur. Bu nedenle popülasyonun dişlerini korumak için su genellikle florlanır. Bu genellikle flor içeren üç kimyasaldan biriyle (sodyum florür, sodyum florosilikat ve hidroflorosilikat asit) yapılır, ancak bu makale bu amaçla Yeni Zelanda'da en yaygın kullanılan kimyasal olan hidroflorosilik asit üzerine odaklanmaktadır. Hidroflorosilik asit üretimi, iki aşamalı bir işlem olarak görülebilir, ancak gerçekte doğru asit konsantrasyonunun elde edilmesini sağlamak için dört aşamada gerçekleştirilmektedir.
Adım 1 - SiF4 Üretimi Süperfosfat üretim süreci, karbondioksit, buhar ve SiF4 oluşumuyla sonuçlanır.
Bu SiF4, çevreyi kirleten bir maddedir ve bu nedenle gaz akışından çıkarılır ve florosilik asit üretmek için kullanılır.
Adım 2 - SiF4'ün Hidrolizi SiF4, gazın su damlacıklarıyla temas ettirilmesiyle gaz akımından uzaklaştırılır.
Bu su SiF4'ü aşağıdaki şekilde hidrolize eder: 3SiF4 + 2H2O → 2H2SiF6 + SiO2 Elde edilen hidroflorosilik asit (H2SiF6) içme suyunu florlamak için kullanılır.

GİRİŞ Batı dünyasının pek çok şehrinde, insanların dişlerinin çürümesini önlemek için içme suyu florüre edilmektedir.
Flor bunu, hidroksiapatit (Ca5 (PO4) 3OH) floroapatit (Ca5 (PO4) 3F) ile değiştirerek elde eder.
Floroapatit asit saldırısına karşı daha dirençlidir ve bu nedenle küçük bir oranda floroapatit içeren dişlerin çürümesi daha az olasıdır.
İlgili reaksiyonlar aşağıdaki gibidir: Diş çürüğü: Ca5 (PO4) 3OH (s) + 4H3O + (aq) → 5Ca2 + (aq) + 3HPO4 2- (aq) + 5H2O (l) Florlama: Ca5 (PO4) 3OH (s) + F- (aq) → Ca5 (PO4) 3F (s) + OH- (aq) Yeni Zelanda'da suyun florlanması büyük ölçüde kabul edilmektedir ve su kaynaklarının florür seviyesini ayarlamayan yalnızca iki büyük şehir vardır. Referandum, florüre edilip edilmeyeceği konusunda kamuoyunun belirlenmesinde norm haline geliyor. Bu amaçla, sodyum florür, sodyum flüosilikat ve hidroflorosilik asit (HFA) olmak üzere üç kimyasal ortak kullanımdadır. Sodyum florür Sodyum florür, suda orta derecede çözünür (ağırlıkça yaklaşık% 3) beyaz bir tozdur.
Su I-Kimyasallar-C-Hidroflorosilik asit-2 florlama amaçları için, suda doymuş bir çözelti hazırlamak ve bu çözeltiyi dökme suya enjekte etmek olağandır.
Bununla birlikte, sodyum florür üçü arasında en pahalıdır ve bu nedenle yaygın olarak kullanılmamaktadır.
Sodyum florosilikat Sodyum florosilikat, suda idareli çözünür (yaklaşık% 0.6 w / w) beyaz bir tozdur. Bu düşük çözünürlük, doymuş bir çözelti kullanmanın mümkün olmadığı anlamına gelir, bu nedenle kuru katı, uygun oranda dökme suya beslenir. Bununla birlikte, küçük katı akışlarını kontrol etmek zor olabilir ve florlama ekipmanının bu yönü iyi tasarlanmalı ve dikkatle izlenmelidir. Bununla birlikte, florosilikat, florür tuzundan önemli ölçüde daha ucuz olduğu için yaygın olarak kullanılmaktadır.
Hidroflorosilisik asit Hidroflorosilisik asidin birçok avantajı vardır. Sıvı olduğundan kullanımı ve toplu suya doğru bir şekilde ölçülmesi kolaydır. Tesis operatörlerinin ince tozları manuel olarak işlemesi gerekmez. Asit aynı zamanda en ucuz flor kaynağıdır.
Bununla birlikte, aşındırıcıdır ve özellikle% 20'nin üzerindeki konsantrasyonlarda duman oluşturma eğilimindedir.
Ana dezavantajı, nispeten seyreltik bir florür kaynağı olmasıdır. % 15 asit kütlece% 12'nin biraz altında flor içerirken, sodyum florür% 47 ve sodyum florosilikat% 60 içerir. Uzun mesafeli nakliye maliyetleri, katı kimyasalları daha çekici hale getirebilir.
Tüm süperfosfat üreticileri, yan ürün olarak hidroflorosilik asit üretirler.
HİDROFLOROSİLİSİK ASİT ÜRETİM SÜRECİ
Adım 1 - SiF4 Süperfosfat üretimi, ince öğütülmüş fosfat kayası ve sülfürik asidin karıştırılmasıyla üretilir.
Önemli miktarda gaz çıkışı ile şiddetli bir reaksiyon meydana gelir. Açığa çıkan gazlar esas olarak buhar ve karbondioksittir, ancak aynı zamanda az miktarda silikon tetraflorür de açığa çıkar (önceki makale).
Bu gazın atmosfere kontrolsüz salınımı önemli kirliliğe neden olabilir, bu nedenle her gübre fabrikasında üretim tesisinin ayrılmaz bir parçası olarak bir gaz yıkayıcı bulunur.
Adım 2 - SiF4 Silisyum tetraflorürün hidrolizi su ile kolayca reaksiyona girer, bu nedenle diğer gazlardan, esasen ince bölünmüş su damlacıklarıyla gaz akışını temas ettirmenin bir yolu olan bir gaz yıkayıcı ile uzaklaştırılır.
Su ile reaksiyon, silikon tetraflorürü denkleme göre hidrolize eder: 3SiF4 + 2H2O → 2H2SiF6 + SiO2
 Bu şekilde florürün% 99'u gaz akışından çıkarılır ve geriye sadece çok küçük bir miktar yayılır.
Bu emisyonlar bir deşarj izni kapsamındadır ve 0,1 g s-1 florürden daha azı atmosfere boşaltılır.
Yıkayıcıdan gelen sıvı genellikle, içinde asılı az miktarda katı silika bulunan seyreltik bir hidroflorosilik asit çözeltisidir.
Bu seyreltik hidroflorosilik asit, süperfosfat üretiminde sülfürik asit yerine kısmen ikame edilebilir.
Farmers Fertilizer Ltd'nin New Plymouth işlerinde yıkama işlemi su floridasyonuna uygun bir asit üretecek şekilde değiştirildi.
Bu çalışmalarda, yıkama I-Kimyasallar-C-Hidroflorosilik asit-3 işlemi, her birinde farklı konsantrasyonlarda asit bulunan üç aşamaya bölünmüştür.
Bu, yerel yetkililer tarafından kabul edilebilir olan yaklaşık% 20 H2SiF6 içeren bir asit verir. Süperfosfat ürünü, hidroflorosilik asit üretimi için tipik bir yıkayıcı kurulumunu gösteren bir akış şemasına sahiptir.
Su ve gaz, florür bakımından zengin gazın güçlü asitle temas etmesi ve florürde zayıf olan gazın çok seyreltik asitle karşılaşması için birbirlerine “karşı akım” akması sağlanır.
Güçlü asit ilk yıkayıcıdan pompalanır ve satılmadan önce silisi uzaklaştırmak için çökeltilir.
ÇEVRESEL VE ​​MALİ HUSUSLAR
Bu işlem, florürü gaz akışından uzaklaştırır, böylece çevresel bir tehlikeyi önler, ancak kendi sorunları vardır.
% 20 asit çoğu metal için çok aşındırıcıdır, bu nedenle yıkama ekipmanı, düz su spreylerinde kullanılandan daha maliyetlidir.
Ancak Kuzey Adası'ndaki talep ekonomik toparlanmayı haklı çıkarmak için yeterli.

Kimyasalların sentezinde ara ürün olarak, temizleme ve dezenfeksiyon için işlem yardımcı aracı olarak karıştırma, hazırlama veya yeniden ambalajlamada kullanılır. Su florlamada, metal yüzeylerinin işlenmesinde, bazik metallerin üretiminde, minerallerin asit ayrıştırmasında, profesyonel temizlik ve dezenfeksiyonda ve ayrıca bir laboratuvar kimyasalı uygulamasında da kullanılmaktadır.

Florosilik asit ve heksaflurosilik asit olarak da bilinen hidroflurosilik asit, çeşitli endüstriyel uygulamalarda kullanılan berrak, renksiz bir sıvıdır. Rakip teknolojilere göre kullanım kolaylığı nedeniyle hidroflurosilik asit, su floridasyon uygulamalarında yaygın olarak kullanılmaktadır. Hidroflurosilik asit ayrıca duvarcılık ve seramiklerin sertleştirilmesinde, metal yüzey işleme ve temizleyici olarak, endüstriyel tekstil işlemede veya çamaşırhanelerde pH ayarlamasında ve kimyasalların üretiminde bir ara ürün olarak kullanılır.

Uyumluluk:

Hidroflurosilik asit, metaller, cam, alkali, seramikler ve güçlü konsantre asitlerle uyumsuzdur. Güçlü konsantre asitler, zehirli hidrojen florürün salınmasına neden olur. Hidroflorosilik asit cama ve seramiklere saldıracak ve metaller hidrojen gazını aşındıracak ve serbest bırakacaktır.

Hidroflorosilik asit çok aşındırıcıdır. Bir inorganik asit, tüm inorganik asitler gibi "güçlü" bir asit olarak sınıflandırılır. (Bir asidin mukavemeti, asidin suda çözündüğünde maruz kaldığı iyonlaşma yüzdesi olarak tanımlanır: asidin konsantrasyonu (suda çözünen asit miktarı) ile hiçbir ilgisi yoktur.] İnorganik asitler düşük konsantrasyonlarda bile oldukça tehlikelidir. iyonlaşma derecesi neredeyse yüzde 100'dür Diğer inorganik asitler arasında sülfürik asit, hidroklorik asit, hidroflorik asit, kromik asit, nitrik asit ve fosforik asit (diğerleri arasında) bulunur.

Organik asitler ise sudaki iyonlaşma dereceleri son derece düşük olduğu için zayıf asitler olarak sınıflandırılır. genellikle yüzde birden çok daha azdır. Organik asitlerin örnekleri arasında asetik asit (sirke içinde bulunur), formik asit (çoğu acı böcekler tarafından enjekte edilen ağrılı madde), laktik asit (ekşi sütte bulunur) ve birçok plastik için bir monomer olan akrilik asit bulunur. Yine, bu dört organik asit binlerce listeden alınmıştır.

Bir asidin mukavemeti genellikle hatalı bir şekilde aşındırıcılığıyla ilişkilendirilir. Genel olarak konuşursak, güçlü asitlerin zayıf asitlerden daha aşındırıcı olduğu doğru olsa da, konsantre zayıf asitler insan dokusu ve diğer malzemeler için çok aşındırıcı olabilir. Bir asidin insan dokusu veya diğer malzemeler için oluşturduğu tehlikeyi "güçlü" veya "zayıf" olarak sınıflandırmaya çalışmayın. Oluşan tehlikeden emin olmak için asidin ne olduğunu ve konsantrasyon seviyesini tam olarak bilmelisiniz.

Hidroflorosilik asit konsantrasyonu yeterince yüksekse, temas ettiği herhangi bir insan dokusuna ciddi şekilde zarar verir. Pure hydrofluorosilicic acid and most concentrations of this acid in water are extremely corrosive: Even relatively low concentrations can severely damage human tissue. The damage can range from simple first-degree bums to very deep, tissue-destroying third-degree burns. Chemical burns are always many times more severe than thermal burns, so severe harm (to the point of causing death) can occur with relatively small areas of tissue damage. Eyes and skin will be severely damaged by contact with concentrated hydrofluorosilicic acid fumes or vapors; the hazards are more far-reaching than those posed by contact with the liquid. If very low concentrations of the acid contact the skin, the damage may be as light and simple as reversible irritation of the tissue involved.


Hexafluorosilicic acid = FLUOROSILICIC ACID = FLUOSILICIC ACID = Sand acid = Silicofluoric acid

Applications of Hexafluorosilicic acid = Chemical Intermediate, Metal Surface Treatment, Water Fluoridation, Wood Preservation, Glass Additive, Ceramic Hardening
Hexafluorosilicic acid is a colorless, water-soluble fluid that is used in many in industrial and municipal operations. It has a pungent odor and is highly corrosive in nature. It is commonly used in applications such as water fluoridation, electroplating, and the manufacturing of cement and enamels. Its growing demand can be attributed to the use of hexafluorosilicic acid in water treatment plants, mainly in the fluoridation of public water supplies.


Hexafluorosilicic acid
EC Number: 241-034-8
EC Name: Hexafluorosilicic acid
CAS Number: 16961-83-4
Molecular formula: F6Si.2H
IUPAC Name: hexafluorosilicate


FLUOROSILICIC ACID    
Hexafluorosilicic acid
Dihydrogen hexafluorosilicate
Fluosilicic acid
Hydrosilicofluoric acid    
CAS #: 16961-83-4    
UN #: 1778
EC Number: 241-034-8


Hexafluorosilicic acid is an inorganic compound with the chemical formula H2SiF6 also written as (H3O)2[SiF6]. 
Hexafluorosilicic acid is a colorless liquid mostly encountered as diluted aqueous solution, from there, the second chemical notation also proposed. 
Hexafluorosilicic acid has a distinctive sour taste and pungent smell. It is produced naturally on a large scale in volcanoes.
Hexafluorosilicic acid is manufactured as a coproduct in the production of phosphate fertilizers. 
The resulting hexafluorosilicic acid is almost exclusively consumed as a precursor to aluminum trifluoride and synthetic cryolite, which are used in aluminium processing. 
Salts derived from hexafluorosilicic acid are called hexafluorosilicates.


Hexafluorosilicic acid is commonly used as a source of fluoride. It is converted to a variety of useful hexafluorosilicate salts. It is also used as an electrolyte in the Betts electrolytic process for refining lead. It is an important organic reagent for cleaving Si-O bonds of silyl ethers. Further, it is used as wood a preservation agent and also used in surface modification of calcium carbonate.


Hexafluorosilicic acid is incompatible in strong oxidizing agents, metals, alkalis, strong acids, stoneware and glass.

Fluosilicic acid, hexafluorosilicic acid
CAS: 16961-83-4
A colorless fuming liquid.

Other Known Names: fluosilicic acid, hexafluorosilicic acid, hydrogen hexafluorosilicate, hydrosilicofluoric acid

Molecular Formula: H2SiF6


The major use of sodium hexafluorosilicate and fluorosilicic acid is as fluoridation agents for drinking water. 
Sodium hexafluorosilicate has also been used for caries control as part of a silicophosphate cement, an acidic gel in combination with monocalcium phosphate monohydrate, and a two-solution fluoride mouth rinse. Both chemicals are also used as a chemical intermediate (raw material) for aluminum trifluoride, cryolite (Na3AlF6), silicon tetrafluoride, and other fluorosilicates and have found applications in commercial laundry. 
Other applications for sodium hexafluorosilicate include its use in enamels/enamel frits for china and porcelain, in opalescent glass, metallurgy (aluminum and beryllium), glue, ore flotation, leather and wood preservatives, and in insecticides and rodenticides. It has been used in the manufacture of pure silicon, as a gelling agent in the production of molded latex foam, and as a fluorinating agent in organic synthesis to convert organodichlorophosphorus compounds to the corresponding organodifluorophosphorus compound. 
In veterinary practice, external application of sodium hexafluorosilicate combats lice and mosquitoes on cattle, sheep, swine, and poultry, and oral administration combats roundworms and possibly whipworms in swine and prevents dental caries in rats. Apparently, all pesticidal products had their registrations cancelled or they were discontinued by the early 1990s. 
Fluorosilicic acid is used in the tanning of animal hides and skins, in ceramics and glass, in technical paints, in oil well acidizing, in the manufacture of hydrogen fluoride, for the sterilization of equipment (e.g., in brewing and bottling establishments and for copper and brass vehicles), and in electroplating. 
It is also employed as an impregnating ingredient to preserve wood and harden masonry and for the removal of mold as well as rust and stain in textiles.

Hexafluorosilicic acid Applications: water fluoridation, disinfecting copper and brass vessels, sterilizing bottling and brewing equipment

Fluorosilicic acid is one of the main products used in water fluoridation

Hydrofluorosilicic acid is a chemical often known by other names like fluorosilicic acid, fluosilicic acid, silicofluoride, and silicofluoric acid and is often abbreviated to HSA or FSA. It is a colorless chemical that is created when you take phosphoric rock from the ground and convert it to soluble fertilizer. In this process, two very toxic fluoride gases are released with hydrogen fluoride being one of them; the other is silicon tetrafluoride. The condensation from this hydrogen fluoride is collected, then scrubbed with water

Hydrofluorosilicic acid is a colorless liquid and inorganic compound that is rarely found undiluted. It has a pungent smell and a characteristic sour taste. Hydrofluorosilicic acid in its concentrated form is toxic and corrosive. It is mainly produced as a precursor to synthetic cryolite and aluminum trifluoride. It is also commonly used in water treatment to maintain the fluoride level in water.

What Industries and Applications Handle Hydrofluorosilicic Acid?
The most commonly known application of hydrofluorosilicic acid is water fluoridation at water treatment plants. It is up to 5 times less expensive than sodium fluoride, an alternative that can also be used to treat drinking water. As a result, hydrofluorosilicic acid has seen a major surge in demand in recent years. However, concentrations above 20 percent are more dangerous to store and handle than sodium fluoride and need adequate care and equipment.

The largest quantity of hydrofluorosilicic acid worldwide is converted to cryolite and aluminum fluoride. These materials are key in the process of converting aluminum ore into aluminum metal.

Hydrofluorosilicic acid is also used as an electrolyte in the Betts electrolytic process for refining lead and as the active compound in some rust removal cleaning products.


Fluorosilic Acid (H2SiF6), is an essential chemical in the following applications:

Water treatment
Surface treatment
Galvanotechnic
Lead refining
Glass industry
Potable water treatment
Ceramic
Chemical Industry
Enamel
Chemical synthesis

Fluorosilicic Acid
Fluorosilicic acid (also known as FSA) is used as a source of fluoride in drinkable water. This assists in preventing cavities in teeth. It is an inorganic compound with the chemical formula (H2SiF6).

Textile Chemicals & Dyes
Fluorosilicic Acid is used for pH adjustment in industrial textile processing or laundries
Textile processing is one of the largest application of fluorosilicic acid with a share of 12.67% in 2019. The product is witnessing increased demand in textile applications owing to its superior cleansing properties. It is used as a laundry chemical or laundry sour as it helps remove rust, stains, and mold from the fabric. The chemical also helps in pH regulation during the rinse cycle. It protects the fiber by forming a thin film coating around the fabric, which results in the reduction of surface tension. These factors are anticipated to fuel the demand from textile processing applications over the forecast period.

Laundry industry has been gaining traction in recent years owing to the changing lifestyle of people and increasing awareness about clean and hygienic clothes. 
This has created a high demand for clean and fragrant clothes. 
In addition, the rising prevalence of allergies and other skin diseases is expected to generate high demand for detergents in the near future. 
Detergent manufacturers are focused on developing high-quality products for efficient cleaning and increasing fabric life along with maintaining hygiene. 
Owing to these factors, fluorosilicic acid is expected to witness healthy demand in textile applications over the forecast period.
Hexafluorosilicic acid is used in removing rust and stains from the fabrics and tend to decrease the surface tension of the substrate by forming a thin film coating around the fiber. Moreover, it acts as a laundry chemical when added to clothes during the rinse cycle to lessen water pH and assist the removal of cleansers and corrosion stains, thereby stimulating the market demand.

Water Treatment
Fluorosilicic Acid is used as a source of fluoride for water fluoridation
Hexafluorosilicic acid is used in public water treatment plants for lessening in dental caries by regulating the fluoride content of public water supplies. 
Hexafluorosilicic acid is added to water treatment plants to give a total fluoride F level of which has been recognized as active component for reducing tooth decay, thereby fueling product demand. Governmental regulations in the U.S. and Europe are compelling the municipal corporations to use fluorosilicic acid as fluoridating agent for public drinking water. Researchers have identified that a controlled level of fluoride in the water effectively prevents cavities and tooth decay. Community water fluoridation is one of the most effective and economical methods to supplement water with fluoride to prevent tooth cavities. Moreover, fluorosilicic acid is predominantly used in the water fluoridation process as a fluoride additive


Others
Fluorosilicic Acid is used as an electrolyte in the Betts electrolytic process for refining lead

A metal surface treatment and cleaner
Fluorosilicic acid with a 40% concentration is highly used in metal surface treatment applications. Aluminum is treated with fluorides, such as fluorosilicic acid, to penetrate through the aluminum oxide layer that forms over the surface of the metal. The process enables fluoride ions to form a protective layer over the aluminum surface, which prevents further oxidation of the metal
Fluorosilicic acid is used by municipal corporation in water treatment process to maintain fluoride level. Hexafluorosilicic acid is widely used in metal surface treatment processes as it induces non-chromium surface passivation which may promote product demand.
Fluorosilicic acid acts as a non-hexavalent chromium formula component with low chlorine content and acts as a stable product during surface treatment process.
 

Hexafluorosilicic acid is used in various chemical industries which act as a catalyst to conventional chromium electrolyte. The product act as a reducing agent in electroplating process,
 

Hydrofluorosilicic acid is widely used in oral care products such as toothpaste, mouth wash, floss and teeth whitening. Global oral care products demand was valued at over USD 28.5 billion in 2018. Increasing consumer awareness for oral disorders such as gingivitis, denture irritation and bleeding gums is likely to boost the fluorosilicic acid market growth. It strengthens weak spots and exposed roots and aid in preventing the early stages of tooth decay.


Hydrofluorosilicic acid product offers excellent properties such as maintaining the fluoride levels when added in dental products. Moreover, increasing application in sterilization and fumigation technologies and increasing demand for animal hide and tanned glass is likely to foster the industry growth.

Hydrofluorosilicic acid is used for hardening masonry and ceramics


Hexafluorosilicic has been used in the manufacture of pure silicon, as a gelling agent in the production of molded latex foam, and as a fluorinating agent in organic synthesis to convert organodichlorophosphorus compounds to the corresponding organodifluorophosphorus compound. 
40 % grade fluorosilicic acid is used in the tanning of animal hides and skins, in ceramics and glass, in technical paints, in oil well acidizing, in the manufacture of hydrogen fluoride, for the sterilization of equipment, and in electroplating. 
Hexafluorosilicic is also employed as an impregnating ingredient to preserve wood and harden masonry and for the removal of mold as well as rust and stain in textiles. 


Fluorosilicic acid is one of the widely used abrasive compounds in the glass industry for glass etching applications. Etched glass products are commonly used in the building and construction industry. A major factor encouraging the growth of the global decorative glass market is the increase in the demand for glass products in commercial and residential buildings. Hence, etched glass products are gaining popularity due to their aesthetic appearance as well as energy savings from reduced electricity consumption. Also, glass provides thermal and sound insulation and allows the control of solar radiation.

 It is used in public water treatment plants for lessening in dental caries by regulating the fluoride content of public water supplies. It is added to water treatment plants to give a total fluoride F level of which has been recognized as active component for reducing tooth decay, thereby fueling product demand. Governmental regulations in the U.S. and Europe are compelling the municipal corporations to use fluorosilicic acid as fluoridating agent for public drinking water. Researchers have identified that a controlled level of fluoride in the water effectively prevents cavities and tooth decay. Community water fluoridation is one of the most effective and economical methods to supplement water with fluoride to prevent tooth cavities. Moreover, fluorosilicic acid is predominantly used in the water fluoridation process as a fluoride additive

LEATHER TANNING APPLICATION OF Hexafluorosilicic acid 
Hexafluorosilicic acid is added in an aqueous dispersion layer form to tanning bath during leather tanning process, making it soft and compliant, which may enhance the product growth.


APPLICATIONS OF HEXAFLUOROSILICIC ACID
Wood Preservatives
Electroplating
Fur Dressing and Dyeing
Glass Manufacturing
Leather Tanning and Processing
Metal Preparation and Pouring
Painting (Pigments, Binders, and Biocides)
Petroleum Production and Refining
Sewer and Wastewater Treatment
Disinfectants and Biocides


Overview.
Fluorosilicic acid, as well as Phosphoric acid, are produced as co-products by acidulation of phosphate rock by sulphuric acid. Phosphate rock contains both calcium phosphate and calcium fluoride, and by acidulation both products are obtained.

Fluorosilicic Acid can only exist as a liquid. There is no solid form. It is rarely encountered undiluted and has a distinctive sour taste and pungent smell.

The largest quantity of hydrofluorosilicic acid worldwide is converted to cryolite and aluminum fluoride. These materials are key in the process of converting aluminium ore into aluminium metal.

CAS Number:
16961-83-4
EC Number:
241-034-8
Appearance:
Colourless
Other Names:
Hexafluorosilicic Acid

Preferred IUPAC name: Hexafluorosilicic acid
Systematic IUPAC name: Dihydrogen hexafluorosilicate
Other names: Fluorosilicic acid, fluosilic acid, hydrofluorosilicic acid, silicofluoride, silicofluoric acid, oxonium hexafluorosilanediuide, oxonium hexafluoridosilicate(2−)

Identifiers
CAS Number: 16961-83-4 
EC Number: 241-034-8
UN number: 1778

Properties
Chemical formula: F6H2Si
Molar mass: 144.091 g·mol−1
Appearance: transparent, colorless, fuming liquid
Odor: sour, pungent

Density    
1.22 g/cm3 (25% soln.)
1.38 g/cm3 (35% soln.)
1.46 g/cm3 (61% soln.)

Melting point
ca. 19 °C (66 °F; 292 K) (60–70% solution)
< −30 °C (−22 °F; 243 K) (35% solution) 

Boiling point: 108.5 °C (227.3 °F; 381.6 K) (decomposes)
Solubility in water: miscible
Refractive index (nD): 1.3465
Structure
Molecular shape    Octahedral SiF62−

Flash point: Non-flammable
Lethal dose or concentration (LD, LC):LD50 (median dose): 430 mg/kg 


Structure
Hexafluorosilicic acid is generally assumed to consist of oxonium ions charge balanced by hexafluorosilicate dianions as well as water. In aqueous solution, the hydronium cation (H3O+) is traditionally equated with a solvated proton, and as such, the formula for this compound is often written as H
2SiF6. Extending that metaphor, the isolated compound is then written as H2SiF6·2H2O, or (H3O)2SiF6.
The situation is similar to that for chloroplatinic acid, fluoroboric acid, and hexafluorophosphoric acid. 
Hexafluorosilicate is an octahedral anion; the Si–F bond distances are 1.71 Å.
Hexafluorosilicic acid is only available commercially as solution

Production and principal reactions
The commodity chemical hydrogen fluoride is produced from fluorite by treatment with sulfuric acid.[5] As a by-product, approximately 50 kg of (H3O)2SiF6 is produced per tonne of HF owing to reactions involving silica-containing mineral impurities. (H3O)2SiF6 is also produced as a by-product from the production of phosphoric acid from apatite and fluorapatite. Again, some of the HF in turn reacts with silicate minerals, which are an unavoidable constituent of the mineral feedstock, to give silicon tetrafluoride. Thus formed, the silicon tetrafluoride reacts further with HF. The net process can be described as:[6]

SiO2 + 6 HF → SiF2−6 + 2 H3O+

Hexafluorosilicic acid can also be produced by treating silicon tetrafluoride with hydrofluoric acid.

In water, hexafluorosilicic acid readily hydrolyzes to hydrofluoric acid and various forms of amorphous and hydrated silica ("SiO2"). 
At the concentration usually used for water fluoridation, 99% hydrolysis occurs and the pH drops. The rate of hydrolysis increases with pH. 
At the pH of drinking water, the degree of hydrolysis is essentially 100%.

H2SiF6 + 2 H2O → 6 HF + "SiO2"
Neutralization of solutions of hexafluorosilicic acid with alkali metal bases produces the corresponding alkali metal fluorosilicate salts:

(H3O)2SiF6 + 2 NaOH → Na2SiF6 + 4 H2O
The resulting salt Na2SiF6 is mainly used in water fluoridation. Related ammonium and barium salts are produced similarly for other applications.

Near neutral pH, hexafluorosilicate salts hydrolyze rapidly according to this equation:

SiF2−6 + 2 H2O → 6 F− + SiO2 + 4 H+

Uses
The majority of the hexafluorosilicic acid is converted to aluminium fluoride and synthetic cryolite.
These materials are central to the conversion of aluminium ore into aluminium metal. The conversion to aluminium trifluoride is described as:

H2SiF6 + Al2O3 → 2 AlF3 + SiO2 + H2O
Hexafluorosilicic acid is also converted to a variety of useful hexafluorosilicate salts. The potassium salt, Potassium fluorosilicate, is used in the production of porcelains, the magnesium salt for hardened concretes and as an insecticide, and the barium salts for phosphors.

Hexafluorosilicic acid is also used as an electrolyte in the Betts electrolytic process for refining lead.

Hexafluorosilicic acid (identified as hydrofluorosilicic acid on the label) along with oxalic acid are the active ingredients used in Iron Out rust-removing cleaning products, which are essentially varieties of laundry sour.

Niche applications
H2SiF6 is a specialized reagent in organic synthesis for cleaving Si–O bonds of silyl ethers. 
It is more reactive for this purpose than HF. It reacts faster with t-butyldimethysilyl (TBDMS) ethers than triisopropylsilyl (TIPS) ethers.

Hexafluorosilicic acid and the salts are used as wood preservation agents.

Natural salts
Some rare minerals, encountered either within volcanic or coal-fire fumaroles, are salts of the hexafluorosilicic acid. Examples include ammonium hexafluorosilicate that naturally occurs as two polymorphs: cryptohalite and bararite.

Safety
Hexafluorosilicic acid can release hydrogen fluoride when evaporated, so it has similar risks. Inhalation of the vapors may cause lung edema. 
Like hydrogen fluoride, it attacks glass and stoneware.
The LD50 value of hexafluorosilicic acid is 430 mg/kg.


Hexafluorosilicic acid Chemical Properties,Uses and Production

Description
Hexafluorosilicic acid is a kind of inorganic acid. It is majorly used for the fluoridation of water in United State to minimize the incidence of dental caries and dental fluorosis. For chemical synthesis, it is majorly used for the manufacturing of aluminum fluoride and cryolite as well as many kinds of hexafluorosilicate salts. It can also be used for the production of silicon and silicon dioxide. It can also be used as an electrolyte in the Betts electrolytic process for refining lead. It is also a specialized reagent in organic synthesis for cleaving Si–O bonds of silyl ethers.

Chemical Properties
Fluosilicic acid,H2SiF6, also known as hydrofluorosilicic acid,is a colorless liquid that is soluble in water. It is highly corrosive and toxic,attacking glass and stoneware. Fluosilicic acid is used in water fluoridation, electroplating, and in manufacturing enamels and cement.

Chemical Properties
Fluorosilicic acid is a transparent, colorless fuming liquid.

Uses
A 1-2% solution is used widely for sterilizing equipment in brewing and bottling establishments. Other concentrations are used in the electrolytic refining of lead, in electroplating, for hardening cement, crumbling lime or brick work, for the removal of lime from hides during the tanning process, to remove molds, as preservative for timber.

General Description
A colorless fuming liquid with a penetrating pungent odor. Corrosive to metals and tissue. Both the fumes and very short contact with the liquid can cause severe and painful burns. Used in water fluoridation, in hardening cement and ceramics, as a wood preservative.

Air & Water Reactions
Fumes in air. Soluble in water with release of heat and corrosive fumes.

Reactivity Profile
Hexafluorosilicic acid can react with strong acids (such as sulfuric acid) to release fumes of toxic hydrogen fluoride. Attacks glass and materials containing silica. Reacts exothermically with chemical bases (examples: amines, amides, inorganic hydroxides). Reacts with active metals, including iron and aluminum to dissolve the metal and liberate hydrogen and/or toxic gases. Can initiate polymerization in certain alkenes. Reacts with cyanide salts and compounds to release gaseous hydrogen cyanide. Flammable and/or toxic gases are also often generated by reactions with dithiocarbamates, isocyanates, mercaptans, nitrides, nitriles, sulfides, and weak or strong reducing agents. Additional gas-generating reactions may occur with sulfites, nitrites, thiosulfates (to give H2S and SO3), dithionites (SO2), and carbonates. Can catalyze (increase the rate of) chemical reactions. Decomposes when heated to the boiling point to produce very toxic and corrosive hydrogen fluoride gas.

Hazard
Extremely corrosive by skin contact and inhalation.

Health Hazard
Inhalation of vapor produces severe corrosive effect on mucous membrane. Ingestion causes severe burns of mouth and stomach. Contact with liquid or vapor causes severe burns of eyes and skin.

Fire Hazard
Special Hazards of Combustion Products: Irritating fumes of hydrogen fluoride may form in fire.

Industrial uses
Hydrofluorosilicic acid (H2SiF6) is a colorless to light brown liquid. It is also manufactured from calcium fluoride or other fluoride-containing products. Hydrofluorosilic acid is a strong depressant for many silicates during flotation of a number of oxidic minerals. It is used for gangue depression during flotation of tin, columbite and tantalite.

Safety Profile
Poison by subcutaneous route. A corrosive irritant to sktn, eyes, and mucous membranes. Will react with water or steam to produce toxic and corrosive fumes. When heated to decomposition it emits toxic fumes of F-. See also FLUORIDES.

Potential Exposure
A solution of fluorosilicic acid is used for sterilization in the brewing and bottling industry, elec trolytic refining of lead; electroplating, hardening cement; removing mold, and others.

Shipping
UN1778 Fluorosilicic acid, Hazard class: 8; Labels: 8-Corrosive material.

Incompatibilities
The aqueous solution is a strong acid. Reacts with water or steam to produce toxic and corrosive fumes of hydrogen fluoride. Incompatible, and may react violently with: bases, aliphatic amines; alkanolamines, alkylene oxides; aromatic amines; amides, ammonia, ammonium hydroxide; calcium oxide; epichlorohydrin, iso cyanates, oleum, organic anhydrides; sulfuric acid; strong oxidizers; vinyl acetate; water. Attacks glass, concrete, and ceramics. The anhydrous form dissociates almost instantly into silicon tetrafluoride and hydrogen fluoride.

Waste Disposal
Add slowly to a large amount of soda ash in solution. Discharge to sewer with large volumes of water


Industry Uses

Agricultural chemicals (non-pesticidal)
Corrosion inhibitors and anti-scaling agents
Flame retardants
Fluorinating agent
Oxidizing/reducing agents
Plating agents and surface treating agents
Processing aids, not otherwise listed
Surface active agents
Water Fluoridation
Water Treatment Processing and other miscellaneous uses
Water treatment
Water treatment chemical - fluoridation
water treatment - fluoridation
water treatment processing

Substance Identifiers
 Trade name
•  Acide fluorosilicique
•  Acide fluosilicique
•  Acide fluosilicique
•  Acido fluosilicico
•  DIHYDROGEN HEXAFLUOROSILICATE(2-)
•  Dihydrogen hexafluorosilicate
•  FLUOROSILICIC ACID
•  FLUOROSILICIC ACID (H2SIF6)
•  FLUOROSILICIC ACID 40% (Solvay Specialty Polymers)
•  FLUOSILICIC ACID
•  FSA
•  Fluorosilicic Acid
•  Fluorosilicic acid
•  HEXAFLUORKIESELSAEURE
•  HEXAFLUOROSILICIC ACID
•  HFS
•  HYDROFLUOROSILICIC ACID
•  HYDROGEN HEXAFLUOROSILICATE
•  Hexafluorosilicic Acid
•  Hexafluosilicic acid
•  Hydrofluorosilicic acid
•  Hydrofluosilicic acid
•  Hydrofluosilicic acid
•  Hydrogen fluorosilicate
•  Hydrogen hexafluorosilicate
•  Hydrogen hexafluorosilicate
•  Hydrosilicofluoric acid
•  Hydrosilicofluororic acid
•  KIESELFLUORWASSERSTOFFSAEURE
•  SILICATE(2-), HEXAFLUORO-, DIHYDROGEN
•  Sand acid
•  Silicate(2-), hexafluoro-, dihydrogen
•  Silicic acid
•  Silicofluoric Acid
•  Silicofluoric acid
•  Silicofluoride
•  Silicofluoride
•  Silicon hexafluoride dihydride
•  Silicon hexafluoride dihydride
•  fluorosilicic acid
•  fluosilicic acid
•  hexafluorosilicic acid
•  hexafluorosilicic acid
•  hydrofluosilicic acid
•  kwas fluorokrzemowy
•  silicofluoric acid

Hexafluorosilicic acid
Fluorosilicic acid
16961-83-4
Dihydrogen hexafluorosilicate
Silicate(2-), hexafluoro-, dihydrogen
MFCD00036289
hexafluorosilicon(2-);hydron
Fluosilicic acid, 25 wt.% aqueous solution
UNII-53V4OQG6U1
hexafluorosilicon(2-); hydron
Kieselfluorwasserstoffsaure
53V4OQG6U1
DTXSID2029741
hexakis(fluoranyl)silicon(2-); hydron
DB-064742
FT-0626488
A811126
Q411250
J-521443


FLUOSILICIC ACID
tetrafluorosilane;dihydrofluoride
Hydrogen hexafluorosilicate
Fluorosilicic acid solution
Sand acid
Silicofluoric acid
Hexafluosilicic acid
Hydrofluosilicic acid
Hydrofluorosilicic acid
Hydrosilicofluoric acid
FLUOROSILIC ACID
H2SiF6
AKOS015903679
Fluorosilicic acid, 22-25% in water
Fluosilicic acid, purum, 33.5-35%
GF10035
SILICATE(2-),HEXAFLUORO-,DIHYDROGEN
Fluorosilicic acid solution, AR,30.0-32.0%
Fluorosilicic acid solution, GR,30.0-32.0%
Fluorosilicic acid solution, 20-25 wt. % in H2O

Chemical dangers
Decomposes on heating. This produces toxic fumes including hydrogen fluoride. The solution in water is a strong acid. It reacts violently with bases and is corrosive. Reacts with water and steam. This produces toxic and corrosive fumes. Attacks glass and stoneware. Attacks many metals. This produces flammable/explosive gas (hydrogen - see ICSC 0001). This substance (anhydrous form) dissociates almost instantly into silicon tetrafluoride and corrosive and toxic hydrogen fluoride. 

Marketed only as aqueous solution.
Solidification point for 60-70% solution: solidifies at about 19°C, forming a crystalline dihydrate.
Other melting points: <-30°C (35% solution).
Relative density for a 61% solution is 1.46 and for 35% solution is 1.38.
Vapour pressure for a 35% solution is about 3 kPa.
The symptoms of lung oedema often do not become manifest until a few hours have passed and they are aggravated by physical effort. Rest and medical observation are therefore essential.
Temperature of decomposition is unknown in the literature.
Immediate administration of an appropriate inhalation therapy by a doctor, or by an authorized person, should be considered. 


Hydrofluorosilicic acid, or H2SiF6, is a challenging chemical because it has properties that pose danger and specific storage concerns. With its common use in water treatment, it’s important that you’re aware of the risks that storing this chemical improperly carries.


How is Hydrofluorosilicic Acid Used
The most commonly discussed application for this chemical is water fluoridation at water treatment plants. This process helps prevent periodontal problems and is added to drinking water. Another common chemical added to drinking water for the same purpose is sodium fluoride, but it can be five times as expensive. Hydrofluorosilicic acid can, however, be more dangerous to store, so it’s important to have a reliable and safe storage solution.

Another use of FSA is to etch glass; the extremely corrosive nature of the chemical is effective for this desired application. We’ll get into storage options in the next section but for this reason, glass or fiberglass tanks are not good storage solutions when eating glass is “not” the intent. 

Hydrofluorosilicic acid is also used in the production of the salts that can contain porcelains


Storage Concerns and Solutions
Hydrofluorosilicic acid is easily the most dangerous chemical at your local water treatment plant. It can release hydrogen fluoride when it evaporates, is corrosive, and can damage the lungs if breathed in, making it especially dangerous for plant employees if stored incorrectly.

FSA also interacts negatively with metals to produce a flammable hydrogen gas, meaning a stainless steel chemical storage tank is not a viable option. It attacks glass, eats through concrete, and poses a serious storage concern. Before rotomolded plastic became a viable storage option, fiberglass tanks, constructed with a resin-rich veil, was often used for storage. The resin-rich veil, however, is often only ⅛” of chemical barrier protection from the incompatible fiberglass (chopped glass) structure itself. Since FSA eats glass, it’s actually incredibly dangerous to store FSA in something that only provides a minimal barrier of safety from a glass-made structural support container.

In these cases, a high-density cross-linked polyethylene (XLPE) storage tank is the safest option, and it’s best to choose one with secondary containment in the event of an issue. With linear polyethylene (HDPE), unzipping (or a catastrophic tear down the side of the tank) is possible, but with XLPE, the structural integrity of the tank will endure even if compromised. An XLPE tank with secondary containment, like Poly Processing’s SAFE-Tank®, can contain the chemical as well as the outlet to the pump transition from the primary tank. Not containing your fitting, the most vulnerable part of an otherwise robust system, is like having no containment in the first place. Another option is to place the pump fitting on top of the tank where chemical can not escape if a fitting fails. This, however, requires special design in the pumping system.

With the popularity of fluoridation occurring in most American water treatment plants, a tank with NSF-61 certification (and specifically for hydrofluorosilicic acid and not just potable water) should be included from the tank manufacturer. XLPE tanks are available with this certification. Always be sure NSF61 designations are for the specific chemical tested (not just water), as NSF offers certification by exact chemical according to Maximum Allowable Levels (MAL).

Hydrofluorosilicic Acid Storage Tank Requirements
The tank needs a reliable shut-off valve to isolate the pump skid, for regular pump inspection. The tank’s pump needs to be checked several times per year to ensure there is no line corrosion that could break and expose workers to the harmful effects of FSA.

An XLPE tank with a full drain is also a good choice for storage of FSA because it can help prevent build-up of deposits. One concern in storing FSA is arsenic build-up, and accumulated lead as discussed above. Some local EPA authorities will dictate special removal procedures of these tanks because of this. A full drain tank, however, will prevent these deposits from building.

Be sure that the full drain is flush with the bottom of the tank and contains no metal inserts for reasons discussed above. Precipitation of silica is a potential problem if dilution ranges get above 10:1. Again, a full drain or IMFO fitting will eliminate this concern.

Is Corrosion A Problem?
Many operators are concerned about HF gas released from concentrated H2SiF6 storage resulting in corrosion since water fluoridation will corrode pipes. Temperatures and concentrations for water fluoridation, however, ensure FSA achieves complete dissociation to fluoride, hydrogen, and silica (sand) and cannot produce HF. Silicates are actually used as a stabilizer for water corrosion. So, in solution, corrosion is not a concern- but venting is.

FLUOROSILICIC ACID

fluorosilicic acid
fluorosilicic acid ... %
Fluosilicic acid
Hexafluorosilicic acid
hexafluorosilicic acid


Translated names
...% fluorsilicio rūgštis (lt)
acid fluorosilicic…% (ro)
acide fluorosilicique à … % (fr)
acide fluosilicique ... % (fr)
acido fluosilicico ... % (it)
Fluoripiihappo...% (fi)
Fluororänihape …% (et)
fluorosilicijska kiselina ... % (hr)
fluskiselsyre ... % (da)
heksafluorkiselsyre ... % (no)
heksafluorosilicijeva kislina...% (sl)
hexafluorkiezelzuur (nl)
Hexafluorokieselsäure ... % (de)
hexafluorokiselsyra ... % (sv)
hexafluorosilicato de hidrógeno ... % (es)
hidrogén-szilícium-hexafluorid …% (hu)
hydrogensilicimhexafluorid ... % (da)
hydrogensilisiumfluorid ... % (no)
Kieselfluorwasserstoffsäure ... % (de)
kiezelfluorwaterstof ... % (nl)
kwas heksafluorokrzemowy ...% (pl)
kyselina hexafluorokremičitá ... % (sk)
kyselina hexafluorokřemičitá .....% (cs)
 … % fluorsilīcijskābe (lv)
ácido fluorosilícico (es)
ácido fluorossilícico em solução ... % (pt)
εξαφθοροπυριτικό οξύ ... % (el)
флуоросилициева киселина % (bg)

CAS names
Silicate(2-), hexafluoro-, hydrogen (1:2)

IUPAC names
Dihydrogen hexafluorosilicate
dihydrogen hexafluorosilicate
Dihydrogen hexafluorosilicate(2-)
fluorosilicic acid
Fluorosilicic acid
fluorosilicic acid ... %
H2SiF6
hexafluoro-kovasav
hexafluorosilcate
hexafluorosilicate
Hexafluorosilicic acid
hexafluorosilicic acid 
Hexafluorosilicic acid
hexafluorosilicic acid
hexafluorosilicic-acid-
hexafluorosilicon(2-); hydron
hexafluorosilicon(2-);hydron


Trade names
Acide fluorosilicique
Acide fluosilicique
Acido fluosilicico
Dihydrogen hexafluorosilicate
DIHYDROGEN HEXAFLUOROSILICATE(2-)
FLUOROSILICIC ACID
Fluorosilicic Acid
Fluorosilicic acid
fluorosilicic acid
FLUOROSILICIC ACID (H2SIF6)
FLUOROSILICIC ACID 40% (Solvay Specialty Polymers)
FLUOSILICIC ACID
fluosilicic acid
FSA
HEXAFLUORKIESELSAEURE
HEXAFLUOROSILICIC ACID
Hexafluorosilicic Acid
hexafluorosilicic acid
Hexafluosilicic acid
HFS
HYDROFLUOROSILICIC ACID
Hydrofluorosilicic acid
Hydrofluosilicic acid
hydrofluosilicic acid
Hydrogen fluorosilicate
HYDROGEN HEXAFLUOROSILICATE
Hydrogen hexafluorosilicate
Hydrosilicofluoric acid
Hydrosilicofluororic acid
KIESELFLUORWASSERSTOFFSAEURE
kwas fluorokrzemowy
Sand acid
SILICATE(2-), HEXAFLUORO-, DIHYDROGEN
Silicate(2-), hexafluoro-, dihydrogen
Silicic acid
Silicofluoric Acid
Silicofluoric acid
silicofluoric acid
Silicofluoride
Silicon hexafluoride dihydride

Other Names

Corticotropin
Dihydrogen hexafluorosilicate
FKS
Fluosilicic acid (6CI)
Fluorosilicic acid
Hexafluorosilicic acid
Hexafluorosilicate (2 - ), dihydrogen
Hexafluosilicic acid
Hydrofluorosilicic acid
Hydrofluosilicic acid
Hydrogen hexafluorosilicate
Hydrogen hexafluorosilicic
Hydrosilicofluoric acid
Sand acid
Silicate (2 - ), hexafluoro-, dihydrogen (8CI, 9CI)
Silicic acid (H2SiF6)
Silicofluoric acid
Silicofluoride Silicon hexafluoride dihydride
UN1778 (DOT)


Hexafluorosilicic Acid is a water insoluble Silicon source for use in oxygen-sensitive applications, such as metal production. In extremely low concentrations (ppm), fluoride compounds are used in health applications. 
Fluoride compounds also have significant uses in synthetic organic chemistry. They are commonly also used to alloy metal and for optical deposition. Certain fluoride compounds can be produced at nanoscale and in ultra high purity forms

Reactivity Profile
FLUOROSILICIC ACID can react with strong acids (such as sulfuric acid) to release fumes of toxic hydrogen fluoride. 
FLUOROSILICIC ACID attacks glass and materials containing silica. 
FLUOROSILICIC ACID reacts exothermically with chemical bases (examples: amines, amides, inorganic hydroxides). 
FLUOROSILICIC ACID reacts with active metals, including iron and aluminum to dissolve the metal and liberate hydrogen and/or toxic gases. 
FLUOROSILICIC ACID can initiate polymerization in certain alkenes. 
FLUOROSILICIC ACID reacts with cyanide salts and compounds to release gaseous hydrogen cyanide. 
FLUOROSILICIC ACID is flammable and/or toxic gases are also often generated by reactions with dithiocarbamates, isocyanates, mercaptans, nitrides, nitriles, sulfides, and weak or strong reducing agents. Additional gas-generating reactions may occur with sulfites, nitrites, thiosulfates (to give H2S and SO3), dithionites (SO2), and carbonates. Can catalyze (increase the rate of) chemical reactions. Decomposes when heated to the boiling point to produce very toxic and corrosive hydrogen fluoride gas.

DIHYDROGEN HEXAFLUOROSILICATE
DIHYDROGEN HEXAFLUOROSILICATE(2-)
FLUOROSILIC ACID
FLUOROSILICIC ACID
FLUOROSILICIC ACID (H2SIF6)
FLUOSILICIC ACID
HEXAFLUOROSILICIC ACID
HEXAFLUOSILICIC ACID
HYDROFLUOROSILICIC ACID
HYDROFLUOSILIC ACID
HYDROFLUOSILICIC ACID
HYDROGEN HEXAFLUOROSILICATE
HYDROGEN HEXAFLUOROSILICATE (H2SIF6)
SAND ACID
SILICOFLUORIC ACID
SILICON HEXAFLUORIDE DIHYDRIDE

•    SILICOFLUORIC ACID
•    HYDROGEN HEXAFLUOROSILICATE
•    HYDROFLUOROSILICIC ACID
•    HYDROFLUOSILICIC ACID
•    HYDROSILICOFLUORIC ACID
•    HEXAFLUOROSILICIC ACID
•    HEXAFLUOSILICIC ACID
•    FLUOSILICIC ACID
•    Fluorosilicic acid 35% 
    Fluorosilicic acid 
    Hexafluorosilicic acid 
    Fluosilicic acid
•    CORTICOTROPHIN
•    CORTICOTROPIN (HUMAN)
•    DIHYDROGEN HEXAFLUOROSILICATE
•    Hexafluorkieselsure
•    Silicate(2-), hexafluoro-, dihydrogen
•    fluorosilicic acid solution
•    Hexafluorosilicic acid, 23% aqueous solution
•    FLUOROSILICIC ACID: 35% IN WATER
•    HEXAFLUOROSILICIC ACID: 35% W/W AQUEOUS SOLUTION
•    ACTH
•    ACTH 1-39
•    ACTH (1-39), HUMAN
•    ADRENOCORTICOTROPIC HORMONE (1-39) (HUMAN)
•    ADRENOCORTICOTROPIC HORMONE HUMAN
•    hexafluorosilicicacid23%solution
•    Sand acid
•    FLUOROSILICIC ACID, 20-25 WT. % SOLUTION IN WATER
•    Hexafluorosilicic acid 25 %
•    HEXAFLUOROSILICIC ACID 34 %, PURE
•    HEXAFLUOROSILICIC ACID 34 %, TECHNICAL
•    HEXAFLUOROSILICIC ACID APPROX. 25 %
•    Hexafluorosilicic acid, 35% aqueous solution
•    Fluorsilicic acid
•    Hexafluorosilicicacid,2aqueoussolution
•    FLUOROSILICIC ACID, 20-25% SOLUTION
•    Silicofluoric acid (35%)
•    Silicate(2-), hexafluoro-, hydrogen (1:2)
•    Fluorosilicic acid, Hexafluorosilicic acid, Hydrogen hexafluorosilicate
•    Hexafluorosilic acid
•    FLUOROSILIC ACID
•    FLUOROSILICIC ACID
•    CORTICOTROPIN A
•    Hexafluorosilicic acid, 35% w/w aq. soln.
•    Hexafluorosilicic acid, 23% w/w aq. soln.
•    Silicofluoric acid: (Fluorosilicic acid)
•    FLUOROSILICIC ACID, 25% in water
•    SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
•    Hexafluorosilicic Acid w/w aq. Soln.
•    Fluorosilicic acid 35%
•    Fluorosilicic acid s
•    Hexafluorosilicic acid (HFS)
•    Fluosilicic acid, 25 wt % aqueous solution 500GR
•    Fluosilicic acid, 25 WT % aqueous solution
•    Hydrosillicofluoric acid
•    FLUOROSILICIC ACID, 22-25% in water

Acide fluorosilicique [French]
Acido fluosilicico [Italian]
Dihydrogen hexafluorosilicate [ACD/IUPAC Name]
Dihydrogenhexafluorosilicat [German] [ACD/IUPAC Name]
Hexafluorosilicate de dihydrogène [French] [ACD/IUPAC Name]
Hexafluorosilicic acid [Wiki]
Silicate(2-), hexafluoro-, dihydrogen [ACD/Index Name]
Acide fluosilicique [French]
Caswell No. 463
CCRIS 2296
DIHYDROGEN HEXAFLUOROSILANEDIUIDE
Dihydrogen hexafluorosilicate (2-)
Dihydrogen hexafluorosilicate(2-)
Fluorosilicic acid
Fluorosilicic acid [UN1778] [Corrosive]
Fluosilicic acid
Hexafluorokieselsaeure [German]
Hexafluorokiezelzuur [Dutch]
Hexafluorosilic acid
Hexafluorosilicic acidaqueous
hexafluorosilicon(2-); hydron
Hexafluosilicic acid
HSDB 2018
Hydrofluorosilicic acid
Hydrofluosilicic acid
Hydrogen hexafluorosilicate
Hydrosilicofluoric acid
Kiezelfluorwaterstofzuur [Dutch]
MFCD00036289 [MDL number]
NSC 16894
Sand acid
SILICOFLUORIC ACID
Silicofluoride
Silicon hexafluoride dihydride
UN1778
氟硅酸 [Chinese]

Hexafluorosilicic acid is sold as a concentrated solution that contains a significant concentration of HF(aq) to prevent dissociation and hydrolysis of the H2SiF6.


The Europe fluorosilicic acid market size was estimated at USD 52.38 million in 2019 and is expected to expand at a compound annual growth rate (CAGR) of 4.5% from 2020 to 2027. High consumption of the product for manufacturing hydrogen fluoride-primarily used as an industrial raw material for manufacturing aluminum, gasoline, and refrigerants-is anticipated to drive the growth of the market. Fluorosilicic acid is a key byproduct obtained from the production process of phosphate fertilizer; wherein sulfuric acid is treated with phosphate rock. This substance is widely used across multiple industries and is preliminarily consumed to formulate various herbicides, refrigerants, gasoline, pharmaceuticals, kitchen utensils, electrical components, plastic products, and others.

Fluorosilicic acid finds numerous applications across several industries; however, its primary application is in the synthesis of hydrogen fluoride. However, in Europe, due to stringent regulations on fluoridation agents used in water, the chemical finds its major application in formulating hydrogen fluoride, aluminum fluoride, and others.

Hydrogen fluoride which is one of the major application industries catered by fluorosilicic acid is used to manufacture hydrofluorocarbons used in refrigerants The consumption for fluorosilicic acid is driven by the rising demand for refrigerants. European countries have reflected high penetration of FMCG companies into the market space, which has resulted in parallelly high consumption of various industrial refrigerants in the region. High sales of packaged food products, canned beverages, and more have resulted in the construction of multiple supermarkets and organized groceries across all European countries. This resulted in higher demand for refrigerants and, therefore, subsequently higher hydrogen fluoride demand in Europe.


Synonyms:
     dihydrogen hexafluorosilicate
     hexafluorosilicic acid
     hexafluorosilicon(2-);hydron
     hydrogen hexafluorosilicate
     silicate(2-), hexafluoro-, dihydrogen


Fluorosilicic acid

Agent Name
Fluorosilicic acid

Alternative Name
Fluosilicic acid

CAS Number
16961-83-4

Formula
F6-Si.2H

Major Category
Toxic Gases & Vapors
Fluorosilicic acid formula graphical representation

Synonyms
Fluosilicic acid; Acide fluorosilicique [French]; Acide fluosilicique [French]; Acido fluosilicico [Italian]; Dihydrogen hexafluorosilicate; Dihydrogen hexafluorosilicate (2-); FKS; Hexafluorokieselsaeure [German]; Hexafluorokieselsaiure [German]; Hexafluorokiezelzuur [Dutch]; Hexafluorosilicic acid; Hexafluosilicic acid; Hydrofluorosilicic acid; Hydrofluosilicic acid; Hydrogen hexafluorosilicate; Hydrosilicofluoric acid; Kiezelfluorwaterstofzuur [Dutch]; Sand acid; Silicate (2-), hexafluoro-, dihydrogen; Silicofluoric acid; Silicofluoride; Silicon hexafluoride dihydride; Silicate(2-), hexafluoro-, hydrogen (1:2); [ChemIDplus] UN1778

Category
Acids, Inorganic

Description
Colorless liquid with a sour, pungent odor; [HSDB] Aqueous solution (<=35% fluorosilicic acid): Clear light yellow liquid; [Aldrich MSDS]

Sources/Uses
Used as a chemical intermediate, a disinfectant, a water fluoridating agent, a wood preservative, a masonry and ceramic hardener, and a glass additive; it is also used to treat hides and skins, to electroplate chromium, and to electrolytically refine lead; [HSDB] Used in technical paints, oil well acidizing, and to remove mold, rust, and stains from textiles; [NTP]

Comments
Corrosive to skin; [Quick CPC] High inhalation exposure may cause pulmonary edema; Potential for fluorosis after chronic ingestion or inhalation of aerosol; [ICSC] Marketed strictly as an aqueous solution; Anhydrous form dissociates almost instantly into silicon tetrafluoride and hydrofluoric acid; 60-70% solutions solidify at about 19 deg C, forming a crystalline dihydrate; [Merck Index] Fumes in air; Evolves heat and corrosive fumes on mixing with water; [CAMEO] Causes burns to eyes and skin (second-degree after contact of several minutes); Chronic exposure hazards include osteofluorosis, respiratory impairment, and injury to liver and kidneys; [CHRIS] Chronic exposure may cause changes in bone, corrosion of mucous membranes, coughing, shock, pulmonary edema, fluorosis, coma, and death; [NTP] Causes burns; Inhalation may cause corrosive injuries to upper respiratory tract and lungs; Toxic by ingestion; [Aldrich MSDS] See "FLUORIDES."

APPLICATIONS OF HEXAFLUOROSILICIC ACID
Wood Preservatives
Electroplating
Fur Dressing and Dyeing
Glass Manufacturing
Leather Tanning and Processing
Metal Preparation and Pouring
Painting (Pigments, Binders, and Biocides)
Petroleum Production and Refining
Sewer and Wastewater Treatment
Disinfectants and Biocides


Fluorosilicic Acid, Hexafluorosilicic Acid, Fluosilicic Acid or FSA is also an involuntary byproduct of the phosphoric acid industry that is normally being neutralized and disposed with the phosphogypsum or in a dedicated area.

 

FSA can be of a very beneficial use, it can be used in water fluoridation a normal practice in water treatment industry, it can be also used in the manufacturing of Sodium Fluoride or Aluminium Fluoride which both are used in Aluminium industry to decrease the melting point of Aluminium ore.

 

FSA can be also a source of active silica which is a valuable product that can be used in the phosphoric acid industry itself to neutralize the highly corrosive Hydrofluoric Acid (HF), it can be also used in many other industries.


Synonyms: Hydrofluorosilicic Acid, Hydrofluosilicic Acid, Hydrtosilicofluodie Acid, Fluorosilicic Acid, Silicofluoric Acid, Fluosilicic Acid Raw materials Calcium fluoride, Hydrofluoric acid, Silicon dioxide, Sulphuric acid, Celite Preparation Products Ammonium hexafluorosilicate, Sodium fluoroaluminate, Magnesium fluorosilicate, Potassium tetrafluoroborate, Potassium fluoride, Sodium tetrafluoroborate, MAGNESIUM HEXAFLUOROACETYLACETONATE DIHYDRATE, Chromic acid, Potassium fluorosilicate, Magnesium fluosilicate, Magnesium hexafluorosilicate hexahydrate, Sodium tripolyphosphate, Aluminium fluoride, Sodium fluorosilicate, CUPRIC FLUOROSILICATE, Trisodium hexafluoroaluminate, Ammonium fluoborate, Sodium fluoride, ZINC SILICOFLUORIDE, Lead. 1 FLUORSPAR AND WATER FLUORIDATION CHEMICALS Fluorspar (CaF2) is the most important fluoric containing mineral. About 52% of fluorspar consumption worldwide is used as starting material for the production of hydrofluoric acid; another 18% is used for aluminium fluoride, the fluxing agent in the aluminium industry; and 25 % for the steel industry as a flux to improve the fluidity of slag in steelmaking. 
Fluorspar is the commercial name for the mineral fluorite (calcium fluorite) and it is a major raw material source of fluorine. 
25% of the fluorspar consumption of the European Union is produced by EU member states, mainly by Spain. 
A much larger amount is imported from states like China. 2 Fluorspar deposits are primarly a byproduct of precious and base metal ores, such as lead, silver or zinc. 
Fluorspar deposits vary in mineral composition and are not pure. 
They contain large quantities of silica. 
Small quantities of rare earth elements (REE), strontium and other elements may substitute for calcium within the fluorspar crystal structure. Fluorspar is used directly or indirectly to manufacture such products as aluminium, gasoline, insulating foams, refrigerants, steel, and uranium fuel. 
It is used in the manufacture of Fluorocarbon chemicals, including fluoropolymers, chlorofluorocarbons (CFC's) , hydrochlorofluorocarbons (HCFC's), and hydrofluorocarbons (HFC's). CFC's, HCFC's, HFC's and Hydrofluoric acid (HF).

HF is used as the feedstock in the manufacture of a host of fluorine chemicals used in dielectrics, metallurgy, wood preservatives, herbicides, mouthwashes, dentifrices, plastics and water fluoridation. 
One of its most common end-products is fluorosilicic acid or hexafluorosilicic acid also known as hydrofluosilicic acid, which is used in water fluoridation. 
HF is the primary feedstock for the manufacture of virtually all organic and inorganic fluorine-bearing chemicals and is also a key ingredient in the processing of aluminium and uranium. 
The remaining use of fluorspar consumption is as a flux in steelmaking, in iron and steel foundries, primary aluminium production, glass manufacture, enamels, welding rod coatings, cement production, and other uses or products such as the manufacture of Hexafluorosilicic acid. Trace elements such as lead and arsenic are present in finished products. Hexafluorosilicic acid is sold as a concentrated solution that contains a significant concentration of HF(aq) to prevent dissociation and hydrolysis of the H2SiF6. 
In North America many municipal authorities source the same product using recovered sulphuric acid from acid scrubbers to react with either fluorspar or phosphate rock. 

How is it manufactured? 
Before fluorspar can be used to make hydrofluoric acid, the raw ore must be physically concentrated and purified. Fluorspar is crushed, ground up and purified by froth flotation. First the lead and zinc sulphides are separated and the fluorspar treated with sulphuric acid forming hydrofluoric acid gas (HF). 
The acid grade fluorspar typically contains at least 97 percent calcium fluoride, as well as silica, mixed metal oxides and a trace amounts of arsenic. 
The HF gas then begins a purification process involving the gas being cooled, purified by scrubbing and condensed. 
The crude product may be diluted and sold as an approximately 70 percent hydrofluoric acid solution, or distilled to remove any remaining water and further reduce impurities, and sold as hexafluorosilicic acid (hydrofluorosilicic acid) typically made up to a concentration of 37 to 42 per cent. 
The manufacturing process generates tailing waste consisting of lead and zinc sulfides, spent flotation reagents and corrosive process wastewater

Applications
Cement
Ceramics
Chemical intermediate
Electroplating
Laundry sour
Ore extraction
Sterilizing bottling equipment
Water fluoridation

Hydrofluorosilicic acid can be the most dangerous chemical at a particular facility. In the case of evaporation, it releases hydrogen fluoride that is extremely corrosive and will harm the lungs if it is breathed. In addition, hydrofluorosilicic acid interacts with metals and produces a flammable hydrogen gas. These dangers, along with potential corrosion or leakage, can cause imminent harm to working personnel and equipment. Safety precautions should be a key consideration when choosing the right pump for handling hydrofluorosilicic acid.


When pumping hydrofluorosilicic acid at room temperature, it is strongly recommended to choose a sealless magnetic drive chemical pump made out of Polypropylene. Hydrofluorosilicic acid is extremely corrosive and interacts with all kinds of metals. An Encapsulated Impeller, Carbon Bushing, and Viton O-ring will prevent all forms of leakage and ensure the safety of your working personnel and equipment.


Hydrofluorosilicic Acid; Hydrosilicofluoric acid;
Sand acid; Silicofluoric acid; Fluosilicic acid; Hydrofluorosilicic acid; Hydrofluosilic Acid; Hexafluorosilicic acid; Dihydrogen hexafluorosilicate; 氟硅酸; Hexafluorokieselsäure (Dutch); ácido hexafluorosilicico (Spanish); Acide hexafluorosilicique (French); Silicofluoric acid; Silicofluoride; Silicon hexafluoride dihydride; Fluorosilicic acid; H2SiF6; Hydrogen hexafluorosilicate;


Fluorosilicic acid is a translucent, straw-colored, corrosive liquid comprising the H2SiF6 chemical formulation. It is produced in modern rubber lined equipment containing high industrial purity acid. Fluorosilicic acid is an organic liquid formed by the synthesis of fluoride hydrogen and phosphoric acid. It is commonly used for water fluoridation to control the amount of fluoride in water by municipal corporations and toothpaste. Maintaining fluoride levels helps prevent tooth decay.

MARKET DYNAMICS

Increased consumer demand for water fluoridation, electroplating, and well acidifying oils may boost the size of the market for fluorosilicic acid. 
It is used by municipal corporations in the process of water treatment to control the amount of fluoride. 
Hexafluorosilic acid is commonly used in metal surface treatment processes as it causes non-chromium surface passivation that can stimulate product demand. 
Moreover, increasing demand for products from the textile industry for the removal of stain and rust from textiles is likely to fuel the growth of the hydrofluorosilic industry. 
Further, the product is used for pH adjustment in industrial textile processing or laundry services, thereby driving product growth. Hydrofluorosilic acid is commonly used in oral care products such as toothpaste, mouthwash, floss, and teeth whitening. Growing consumer awareness of oral disorders such as gingivitis, denture irritation, and bleeding gums is likely to fuel industry development. 
It strengthens weak spots and exposed roots and helps prevent early tooth decay, which may stimulate demand for the product. 
Thus all these factors are expected to positively affect the demand of the product.


Water fluoridation is an important preventative measure carried out in much of the western world. 
It results in some of the hydroxyapatite, Ca5(PO4)3OH, of which human tooth enamel is made being replaced by fluoroapatite, Ca5(PO4)3F - a substance significantly more resistant to decay. Thus to protect the teeth of the population, water is often fluoridated. This is usually done with one of three fluorine-containing chemicals (sodium fluoride, sodium fluorosilicate and hydrofluorosilicic acid), but this article focuses on hydrofluorosilicic acid as that is the chemical most commonly used in New Zealand for this purpose. Hydrofluorosilicic acid manufacture can be viewed as a two-step process, although in reality it is carried out in four steps to ensure that the right concentration of acid is obtained. 
Step 1 - Production of SiF4 The superphosphate production process results in the evolution of carbon dioxide, steam and SiF4. 
This SiF4 is an environmental pollutant and so is removed from the gas stream and used to produce fluorosilicic acid. 
Step 2 - Hydrolysis of SiF4 The SiF4 is removed from the gas stream by contacting the gas with water droplets. 
This water hydrolyses the SiF4 as follows: 3SiF4 + 2H2O → 2H2SiF6 + SiO2 The resultant hydrofluorosilicic acid (H2SiF6) is used for fluoridating drinking water.

INTRODUCTION In many cities in the western world, drinking water is fluoridated to help prevent peopleís teeth from decaying. 
Fluorine achieves this by replacing hydroxyapatite (Ca5(PO4)3OH) with fluoroapatite (Ca5(PO4)3F). 
Fluoroapatite is more resistant to acid attack and thus teeth which contain even a small proportion of fluoroapatite are less likely to decay. 
The relevant reactions are as follows: Tooth decay: Ca5(PO4)3OH(s) + 4H3O+ (aq) → 5Ca2+(aq) + 3HPO4 2-(aq) + 5H2O(l) Fluoridation: Ca5(PO4)3OH(s) + F- (aq) → Ca5(PO4)3F(s) + OH- (aq) Fluoridation of water in New Zealand is largely accepted, and there are only two major cities that do not adjust the fluoride level of their water supply. Referendum is becoming the norm for determining public opinion on whether to fluoridate or not. Three chemicals are in common use for this purpose, namely sodium fluoride, sodium fluosilicate and hydrofluorosilicic acid (HFA). Sodium fluoride Sodium fluoride is a white powder, moderately soluble in water (about 3% w/w). 
For water I-Chemicals-C-Hydrofluorosilicic acid-2 fluoridation purposes it is usual to prepare a saturated solution in water and inject this solution into the bulk water. 
However, sodium fluoride is the most expensive of the three and for this reason is not widely used. 
Sodium fluorosilicate Sodium fluorosilicate is a white powder sparingly soluble in water (about 0.6% w/w). This low solubility means that it is not feasible to use a saturated solution so dry solid is fed into bulk water at the appropriate rate. However, it can be difficult to control small flows of solid and this aspect of fluoridation equipment must be well designed and carefully monitored. Nevertheless, the fluorosilicate is widely used as it is significantly cheaper than the fluoride salt. 
Hydrofluorosilicic acid Hydrofluorosilicic acid has several advantages. Being a liquid, it is easy to handle and to meter accurately into the bulk water. Plant operators do not have to manually handle fine powders. The acid is also the cheapest source of fluorine. 
However, it is corrosive and tends to fume, particularly at concentrations of above 20%. 
Its main drawback is that it is a comparatively dilute source of fluoride. 15% acid contains just under 12% fluorine by mass, whereas sodium fluoride contains 47% and sodium fluorosilicate 60%. Over long distance transport costs can make solid chemicals more attractive. 
All manufacturers of superphosphate produce hydrofluorosilicic acid as a by-product. 
THE HYDROFLUOROSILICIC ACID MANUFACTURING PROCESS 
Step 1 - Production of SiF4 Superphosphate is manufactured by mixing together finely ground phosphate rock and sulfuric acid. 
A vigorous reaction occurs with considerable gas evolution. The gases given off are mainly steam and carbon dioxide, but there is also a small quantity of silicon tetrafluoride released (seeprevious article). 
Uncontrolled release of this gas to atmosphere could cause significant pollution so every fertiliser works has a gas scrubber as an integral part of its manufacture plant. 
Step 2 - Hydrolysis of SiF4 Silicon tetrafluoride reacts readily with water, so it is removed from the other gases by a gas scrubber that is essentially a means of contacting the gas stream with finely divided droplets of water. 
The reaction with water hydrolyses the silicon tetrafluoride according to the equation: 3SiF4 + 2H2O → 2H2SiF6 + SiO2
 In this way 99% of the fluoride is removed from the gas stream, leaving only a very small quantity to be emitted. 
These emissions are covered by a discharge permit and less than 0.1 g s-1 fluoride is discharged to the atmosphere. 
The liquid from the scrubber is usually a dilute solution of hydrofluorosilicic acid, with a small amount of solid silica suspended in it. 
This dilute hydrofluorosilicic acid can be partially substituted for sulfuric acid in the production of superphosphate. 
In the New Plymouth works of Farmers Fertiliser Ltd the scrubbing process has been modified so as to produce an acid suitable for water fluoridation. 
In this works the scrubbing I-Chemicals-C-Hydrofluorosilicic acid-3 process is divided into three stages with acid of different concentration in each. 
This yields an acid containing about 20% H2SiF6 which is acceptable to local authorities. The superphosphate article has a flowsheet showing a typical scrubber installation for hydrofluorosilicic acid production. 
Water and gas are made to flow ëcountercurrentí to each other so that gas rich in fluoride is contacted by strong acid and gas weak in fluoride meets very dilute acid. 
Strong acid is pumped away from the first scrubber and settled to remove silica before being sold. 
ENVIRONMENTAL AND FINANCIAL CONSIDERATIONS 
This process removes fluoride from the gas stream, thus preventing an environmental hazard, but it does have its problems. 
The 20% acid is very corrosive to most metals, so scrubbing equipment is more costly than that used with plain water sprays. 
However, the demand in the North Island is sufficient to justify economic recovery.

It is used in mixing, preparation or repackaging, as an interim product in the synthesis of chemicals, as a process auxiliary means for cleaning and disinfection. It is also applied in water fluorination, the treatment of the surfaces of metals, production of basic metals, acid decomposition of minerals, professional cleaning and disinfection as well as a laboratory chemical.

Hydroflurosilicic acid, also known as fluorosilicic acid and hexaflurosilicic acid, is a clear, colorless liquid that is used in a variety of industrial applications. Due to its ease of use over competing technologies, hydroflurosilic acid is commonly used in water fluoridation applications. Hydroflurosilicic acid is also used for hardening masonry and ceramics, as a metal surface treatment and cleaner, pH adjustment in industrial textile processing or laundries, and as an intermediate in the manufacturing of chemicals.

Compatibility:

Hydroflurosilicic acid is incompatible with metals, glass, alkali, ceramics, and strong concentrated acids. Strong concentrated acids will cause the release of poisonous hydrogen fluoride. Hydrofluorosilicic acid will attack glass and ceramics and metals will corrode and liberate hydrogen gas.

Hydrofluorosilicic acid is very corrosive. An inorganic acid, it is classified as a “strong” acid, as are all inorganic acids. (An acid’s strength is defined as the percentage of ionization the acid undergoes when dissolved in water: it has nothing to do with the concentration (the amount of acid dissolved in water) of the acid.] Inorganic acids are highly hazardous even at low concentrations; their degree of ionization is nearly 100 percent. Other inorganic acids include sulfuric acid, hydrochloric acid, hydrofluoric acid, chromic acid, nitric acid, and phosphoric acid (among numerous others).

Organic acids, on the other hand, are classified as weak acids since their degree of ionization in water is extremely low. often considerably less than one percent. Examples of organic acids include acetic acid (present in vinegar), formic acid (the painful substance injected by most stinging insects), lactic acid (present in sour milk), and acrylic acid, a monomer for many plastics. Again, these four organic acids are taken from a list of thousands.

The strength of an acid commonly is erroneously associated with its corrosiveness. Generally speaking, while it is true that strong acids are more corrosive than weak acids, concentrated weak acids can be very corrosive to human tissue and other materials. Do not try to classify the danger an acid poses to human tissue or other materials on the basis of its “strong” or “weak” designation. To be sure of the danger posed, you must know exactly what the acid is and its level of concentration.

If hydrofluorosilicic acid’s concentration is high enough, it will severely damage any human tissue it contacts. Pure hydrofluorosilicic acid and most concentrations of this acid in water are extremely corrosive: Even relatively low concentrations can severely damage human tissue. The damage can range from simple first-degree bums to very deep, tissue-destroying third-degree burns. Chemical burns are always many times more severe than thermal burns, so severe harm (to the point of causing death) can occur with relatively small areas of tissue damage. Eyes and skin will be severely damaged by contact with concentrated hydrofluorosilicic acid fumes or vapors; the hazards are more far-reaching than those posed by contact with the liquid. If very low concentrations of the acid contact the skin, the damage may be as light and simple as reversible irritation of the tissue involved.


 

Bu internet sitesinde sizlere daha iyi hizmet sunulabilmesi için çerezler kullanılmaktadır. Çerezler hakkında detaylı bilgi almak için Kişisel Verilerin Korunması Kanunu mevzuat metnini inceleyebilirsiniz.